H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000091666 Accession number: BC028886 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to CREB-regulated transcription coactivator 2; Transducer of regulated cAMP response element-binding protein 2; TORC-2; Transducer of CREB protein 2;
 
 

Motif information
ORF

length(157),orf(3:476)
PGPSGHGQQSYHRPMSDFNLGNLEQFSMESPSASLVLDPPGFSEGPGFLG
GEGPMGGPQDPHTFNHQNLTHCSRHGSGPNIILTGDSSPGFSKEIAAALA
GVPGFEVSAAGLELGLGLEDELRMEPLGLEGLNMLSDPCALLPDPAVEES
FRSDRLQ*
a.a.
length
InterPro Name
length(157), motif(1:157) 157 IPR024786 Transducer of regulated CREB activity [Family]
length(78), motif(79:156) 78 IPR024785 Transducer of regulated CREB activity, C-terminal [Domain]