H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000093469 Accession number: BC034563 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Golgi resident protein GCP60; Acyl-CoA-binding domain-containing protein 3; Golgi complex-associated protein 1; GOCAP1; Golgi phosphoprotein 1; GOLPH1; PBR- and PKA-associated protein 7; Peripheral benzodiazepine receptor-associated protein PAP7;
 
 

Motif information
ORF

length(360),orf(1:1083)
CHLFSTYVASHKIEKEEQEKKRKEEEERRRREEEERERLQKEEEKRRREE
EERLRREEEERRRIEEERLRLEQQKQQIMAALNSQTAVQFQQYAAQQYPG
NYEQQQILIRQLQEQHYQQYMQQLYQVQLAQQQAALQKQQEVVVAGSSLP
TSSKVNATVPSNMMSVNGQAKTHTDSSEKELEPEAAEEALENGPKESLPV
IAAPSMWTRPQIKDFKEKIQQDADSVITVGRGEVVTVRVPTHEEGSYLFW
EFATDNYDIGFGVYFEWTDSPNTAVSVHVSESSDDDEEEEENIGCEEKAK
KNANKPLLDEIVPVYRRDCHEEVYAGSHQYPGRGVYLLKFDNSYSLWRSK
SVYYRVYYTR*
a.a.
length
InterPro Name
length(143), motif(216:358) 143 IPR009038 GOLD [Domain]
length(55), motif(222:276) 55 IPR009038 GOLD [Domain]
length(131), motif(229:359) 131 IPR009038 GOLD [Domain]
length(53), motif(307:359) 53 IPR009038 GOLD [Domain]