H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000096021 Accession number: BC040145 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: ETS domain-containing protein Elk-4; Serum response factor accessory protein 1; SAP-1; SRF accessory protein 1;
 
 

Transcript original information
Accession number BC040145.1
CAGE tag ID NA
EST ID NA
Clone Number IMAGE:5497014
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (SLC45A3) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (SLC45A3);
Sequence data provider NA
Annotation project NA
Length of cDNA 2538[bp] (No. of exon:10)[A:691 T:557 G:627 C:663]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Lymph, lymphoma
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 2522(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NMD predicted; 
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0028754
Genomic location  G-integra Help Chromosome 1
Location 1q32.1
Position 205566697- 205601021
Strand -
Possible duplicated location(s) NA
Gene structure 10 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:2005
KEGG GENES KEGG GENES(2005)
GeneCard GeneCardSLC45A3*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000042681
Predicted CDS 272..1567;  431[aa];  Orientation:+2; 
Codon Adaptation Index (CAI). 0.753
Database links RefSeq NP_001964
UniProt P28324
CCDS CCDS1456

Motif information
ORF

length(431),orf(272:1567)
MDSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKN
KPNMNYDKLSRALRYYYVKNIIKKVNGQKFVYKFVSYPEILNMDPMTVGR
IEGDCESLNFSEVSSSSKDVENGGKDKPPQPGAKTSSRNDYIHSGLYSSF
TLNSLNSSNVKLFKLIKTENPAEKLAEKKSPQEPTPSVIKFVTTPSKKPP
VEPVAATISIGPSISPSSEETIQALETLVSPKLPSLEAPTSASNVMTAFA
TTPPISSIPPLQEPPRTPSPPLSSHPDIDTDIDSVASQPMELPENLSLEP
KDQDSVLLEKDKVNNSSRSKKPKGLELAPTLVITSSDPSPLGILSPSLPT
ASLTPAFFSQTPIILTPSPLLSSIHFWSTLSPVAPLSPARLQGANTLFQF
PSVLNSHGPFTLSGLDGPSTPGPFSPDLQKT*
a.a.
length
InterPro Name
length(93), motif(2:94) 93 IPR011991 Winged helix-turn-helix DNA-binding domain [Domain]
length(86), motif(4:89) 86 IPR000418 Ets domain [Domain]
length(82), motif(5:86) 82 IPR000418 Ets domain [Domain]
length(81), motif(5:85) 81 IPR000418 Ets domain [Domain]
length(14), motif(5:18) 14 IPR000418 Ets domain [Domain]
length(9), motif(7:15) 9 IPR000418 Ets domain [Domain]
length(19), motif(29:47) 19 IPR000418 Ets domain [Domain]
length(19), motif(48:66) 19 IPR000418 Ets domain [Domain]
length(16), motif(51:66) 16 IPR000418 Ets domain [Domain]
length(19), motif(67:85) 19 IPR000418 Ets domain [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000096021
H-Inv cluster ID Locus viewHIX0028754
Accession number BC040145.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help Representative H-Inv IDRepresentative transcript;  Splicing isoformSplicing isoform
Coding potential  Help Protein coding; 
Definition ETS domain-containing protein Elk-4; Serum response factor accessory protein 1; SAP-1; SRF accessory protein 1;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (P28324)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 133930782934749734357154893341969033222722849ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol SLC45A3
HGNC aliases "prostate cancer associated protein 6", "prostate cancer associated protein 2", "prostate cancer associated protein 8"
HGNC name solute carrier family 45, member 3
DDBJ NA
UniProt ELK4
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000042681
No. of interaction NA
Interaction partner(s) NA
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:2005
KEGG GENES KEGG GENES(2005)
GeneCard GeneCardSLC45A3*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Human curated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function sequence-specific DNA binding (GO:0043565);  transcription factor activity (GO:0003700); 
Biological process regulation of transcription, DNA-dependent (GO:0006355); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT nuclear; 
Target P signal peptide
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
1 93 1bc7C 1e-31 100.0 93/93 a.4.5.21
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsA011618;  AGhsA251407; 
Affymetrix
GeneChip
HG-Focus NA
HG-U133 205994_at;  239304_at; 
HG-U133A 205994_at; 
HG-U133A_2 205994_at; 
HG-U133B 239304_at; 
HG-U133_Plus_2 205994_at;  239304_at; 
HG-U95 38497_at; 
HG-U95A 38497_at; 
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 2376573;  2376594;  2452573;  2452577;  2452581;  2452587;  2452588;  2452589;  2452592;  2452593;  2452594;  2452595;  2452605;  2452606;  2452607; 
HuGeneFL M85165_at; 
Agilent Human 1A Oligo Microarray:PGID215 A_23_P161098; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P161098; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Evolutionary information  Evola Help Last modified:27-May-2015
Relationship Species Accession number MGI Links
Orthology Bos sp. (Cow) BC133356 G-integraG-integra
Orthology Canis sp. (Dog) ENSCAFT00000039294 G-integraG-integra
Orthology Danio sp. (Zebrafish) ENSDART00000016615 G-integraG-integra
Orthology Equus sp. (Horse) ENSECAT00000006690 G-integraG-integra
Orthology Oryzias sp. (Medaka) ENSORLT00000015310 G-integraG-integra
Orthology Pongo sp. (Orangutan) ENSPPYT00000000339 G-integraG-integra
Orthology Pan sp. (Chimpanzee) ENSPTRT00000046421 G-integraG-integra
Orthology Tetraodon sp. (Tetraodon) GSTENT00014173001 G-integraG-integra
Orthology Takifugu sp. (Fugu) SINFRUT00000153921 G-integraG-integra
Orthology Rattus sp. (Rat) XM_001059832 G-integraG-integra
Orthology Macaca sp. (Macaque) XM_001087748 G-integraG-integra
Orthology Monodelphis sp. (Opossum) XM_001365494 G-integraG-integra
Orthology Mus sp. (Mouse) Z36885 MGI:102853 G-integraG-integra
Phylogenetic tree [View by ATV]
Neighbor-joining (phb) 
Related H-InvDB links EvolaEvoladN/dS (under constraction); 

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
45 .. 45 G/T rs7417466 - 5'UTR
216 .. 216 A/G rs141200476 - 5'UTR
278 .. 278 A/G rs146371497 - CDS Nonsynonymous[Ser3Gly]
284 .. 284 A/G rs138936782 - CDS Nonsynonymous[Ile5Val]
298 .. 298 G/T rs141838398 - CDS Nonsynonymous[Gln9His]
310 .. 310 G/C rs147053192 - CDS Nonsynonymous[Gln13His]
318 .. 318 A/G rs139169305 - CDS Nonsynonymous[Gln16Arg]
357 .. 357 A/G rs149095787 - CDS Nonsynonymous[Asn29Ser]
372 .. 372 A/G rs150376325 - CDS Nonsynonymous[Lys34Arg]
457 .. 457 C/G rs190546616 - CDS Synonymous[Ala62Ala]
496 .. 496 G/C rs146671060 - CDS Synonymous[Val75Val]
583 .. 583 C/T rs139855067 - CDS Synonymous[Asp104Asp]
601 .. 601 C/T rs142399517 - CDS Synonymous[Phe110Phe]
609 .. 609 T/C rs113173768 - CDS Nonsynonymous[Val113Ala]
617 .. 617 A/C rs144365511 - CDS Nonsynonymous[Ser116Arg]
638 .. 638 G/A rs145878431 - CDS Nonsynonymous[Gly123Arg]
650 .. 650 A/G rs139238464 - CDS Nonsynonymous[Lys127Glu]
657 .. 657 C/T rs186491224 - CDS Nonsynonymous[Pro129Leu]
683 .. 683 C/T rs143034780 - CDS Nonsynonymous[Arg138Cys]
769 .. 769 A/C rs183574998 - CDS Synonymous[Ile166Ile]
778 .. 778 G/T rs199770695 - CDS Nonsynonymous[Glu169Asp]
787 .. 787 C/T rs149424146 - CDS Synonymous[Ala172Ala]
794 .. 794 C/A rs201659900 - CDS Nonsynonymous[Leu175Met]
870 .. 870 C/T rs148037437 - CDS Nonsynonymous[Pro200Leu]
871 .. 871 G/A rs1064406 + CDS Synonymous[Pro200Pro]
931 .. 931 A/G rs144596474 - CDS Synonymous[Glu220Glu]
990 .. 990 C/T rs146453123 - CDS Nonsynonymous[Thr240Ile]
1016 .. 1016 T/C rs139845492 - CDS Nonsynonymous[Phe249Leu]
1039 .. 1039 G/A rs200645347 - CDS Synonymous[Ser256Ser]
1049 .. 1049 C/A rs142937236 - CDS Nonsynonymous[Pro260Thr]
1060 .. 1060 A/G rs147546267 - CDS Synonymous[Glu263Glu]
1071 .. 1071 C/T rs140713422 - CDS Nonsynonymous[Thr267Ile]
1097 .. 1097 C/A rs201588267 - CDS Nonsynonymous[Pro276Thr]
1136 .. 1136 C/G rs61757373 - CDS Nonsynonymous[Pro289Ala]
1137 .. 1137 C/G rs149593454 - CDS Nonsynonymous[Pro289Arg]
1139 .. 1139 A/G rs201988795 - CDS Nonsynonymous[Met290Val]
1149 .. 1149 C/G rs191743893 - CDS Nonsynonymous[Pro293Arg]
1162 .. 1162 A/T rs1064407 + CDS Synonymous[Ser297Ser]
1208 .. 1208 G/A rs34515238 - CDS Nonsynonymous[Val313Ile]
1259 .. 1259 A/G rs200321599 - CDS Nonsynonymous[Thr330Ala]
1339 .. 1339 A/G rs150183128 - CDS Synonymous[Ala356Ala]
1411 .. 1411 C/T rs145530731 - CDS Synonymous[Leu380Leu]
1422 .. 1422 C/T rs185116728 - CDS Nonsynonymous[Ala384Val]
1448 .. 1448 G/A rs141799598 - CDS Nonsynonymous[Gly393Ser]
1503 .. 1503 C/T rs192312174 - CDS Nonsynonymous[Thr411Ile]
1596 .. 1596 A/G rs112981968 - 3'UTR
1807 .. 1807 G/C rs183791164 - 3'UTR
1844 .. 1844 G/A rs115690529 - 3'UTR
1896 .. 1896 A/G rs191483663 - 3'UTR
1949 .. 1949 G/A rs146937031 - 3'UTR
2043 .. 2043 A/C rs113175302 - 3'UTR
2058 .. 2058 G/A rs16855989 - 3'UTR
2076 .. 2076 G/A rs185503480 - 3'UTR
2236 .. 2236 C/T rs182068913 - 3'UTR
2256 .. 2256 C/T rs28657368 - 3'UTR
2457 .. 2457 C/T rs111932303 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
Type Start End Strand
MIRc 2163 2219 +
AluJr 2387 2528 +
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer