H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000096021 Accession number: BC040145 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: ETS domain-containing protein Elk-4; Serum response factor accessory protein 1; SAP-1; SRF accessory protein 1;
 
 

Motif information
ORF

length(431),orf(272:1567)
MDSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKN
KPNMNYDKLSRALRYYYVKNIIKKVNGQKFVYKFVSYPEILNMDPMTVGR
IEGDCESLNFSEVSSSSKDVENGGKDKPPQPGAKTSSRNDYIHSGLYSSF
TLNSLNSSNVKLFKLIKTENPAEKLAEKKSPQEPTPSVIKFVTTPSKKPP
VEPVAATISIGPSISPSSEETIQALETLVSPKLPSLEAPTSASNVMTAFA
TTPPISSIPPLQEPPRTPSPPLSSHPDIDTDIDSVASQPMELPENLSLEP
KDQDSVLLEKDKVNNSSRSKKPKGLELAPTLVITSSDPSPLGILSPSLPT
ASLTPAFFSQTPIILTPSPLLSSIHFWSTLSPVAPLSPARLQGANTLFQF
PSVLNSHGPFTLSGLDGPSTPGPFSPDLQKT*
a.a.
length
InterPro Name
length(93), motif(2:94) 93 IPR011991 Winged helix-turn-helix DNA-binding domain [Domain]
length(86), motif(4:89) 86 IPR000418 Ets domain [Domain]
length(82), motif(5:86) 82 IPR000418 Ets domain [Domain]
length(81), motif(5:85) 81 IPR000418 Ets domain [Domain]
length(14), motif(5:18) 14 IPR000418 Ets domain [Domain]
length(9), motif(7:15) 9 IPR000418 Ets domain [Domain]
length(19), motif(29:47) 19 IPR000418 Ets domain [Domain]
length(19), motif(48:66) 19 IPR000418 Ets domain [Domain]
length(16), motif(51:66) 16 IPR000418 Ets domain [Domain]
length(19), motif(67:85) 19 IPR000418 Ets domain [Domain]