H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000100083 Accession number: BT007163 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Alpha-enolase; EC=4.2.1.11; 2-phospho-D-glycerate hydro-lyase; C-myc promoter-binding protein; Enolase 1; MBP-1; MPB-1; Non-neural enolase; NNE; Phosphopyruvate hydratase; Plasminogen-binding protein;
 
 

Transcript original information
Accession number BT007163.1
CAGE tag ID NA
EST ID NA
Clone Number GH00764X1.0
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (ENO1) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (ENO1);
Sequence data provider NA
Annotation project NA
Length of cDNA 1305[bp] (No. of exon:11)[A:323 T:286 G:371 C:325]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type NA
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature Truncation; 
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0000101
Genomic location  G-integra Help Chromosome 1
Location 1p36.23
Position 8921420- 8934967
Strand -
Possible duplicated location(s) NA
Gene structure 11 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:2023
KEGG GENES KEGG GENES(2023)
GeneCard GeneCardENO1*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000099039
Predicted CDS 1..1305;  434[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.805
Database links RefSeq NP_001419
UniProt P06733
CCDS CCDS97

Motif information
ORF

length(434),orf(1:1305)
MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELR
DNDKTRYMGKGVSKAVEHINKTIAPALVSKKLNVTEQEKIDKLMIEMDGT
ENKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGNSEVILPVPAF
NVINGGSHAGNKLAMQEFMILPVGAANFREAMRIGAEVYHNLKNVIKEKY
GKDATNVGDEGGFAPNILENKEGLELLKTAIGKAGYTDKVVIGMDVAASE
FFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDPFDQDD
WGAWQKFTASAGIQVVGDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSV
TESLQACKLAQANGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCR
SERLAKYNQLLRIEEELGSKAKFAGRNFRNPLAK*
a.a.
length
InterPro Name
length(432), motif(1:432) 432 IPR000941 Enolase [Family]
length(124), motif(3:126) 124 IPR029017 Enolase N-terminal domain-like [Domain]
length(136), motif(3:138) 136 IPR029017 Enolase N-terminal domain-like [Domain]
length(132), motif(3:134) 132 IPR020811 Enolase, N-terminal [Domain]
length(427), motif(3:429) 427 IPR000941 Enolase [Family]
length(15), motif(35:49) 15 IPR000941 Enolase [Family]
length(17), motif(107:123) 17 IPR000941 Enolase [Family]
length(304), motif(128:431) 304 IPR029065 Enolase C-terminal domain-like [Domain]
length(289), motif(143:431) 289 IPR029065 Enolase C-terminal domain-like [Domain]
length(289), motif(143:431) 289 IPR020810 Enolase, C-terminal [Domain]
length(14), motif(164:177) 14 IPR000941 Enolase [Family]
length(12), motif(317:328) 12 IPR000941 Enolase [Family]
length(14), motif(340:353) 14 IPR020809 Enolase, conserved site [Conserved_site]
length(15), motif(340:354) 15 IPR000941 Enolase [Family]
length(18), motif(369:386) 18 IPR000941 Enolase [Family]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000100083
H-Inv cluster ID Locus viewHIX0000101
Accession number BT007163.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Alpha-enolase; EC=4.2.1.11; 2-phospho-D-glycerate hydro-lyase; C-myc promoter-binding protein; Enolase 1; MBP-1; MPB-1; Non-neural enolase; NNE; Phosphopyruvate hydratase; Plasminogen-binding protein;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (P06733)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 13692092005901237308135290907787969882471691101749150948930876096536459878089100825541068158910802057111343511149723912297304126661331470203915489334155924551613979816548883167104141681597517974005186696481960886119690332200682312126946021908771ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol ENO1
HGNC aliases NA
HGNC name enolase 1, (alpha)
DDBJ NA
UniProt ENO1
EC number EC 4.2.1.11phosphopyruvate hydratase; 
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway 00010 :Glycolysis / Gluconeogenesis;  00400 :Phenylalanine, tyrosine and tryptophan biosynthesis; 
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000099039
No. of interaction 5
Interaction partner(s) HIP000034294HIP000082842HIP000091335HIP000120293HIP000136154
BIND 145679; 
DIP 133943E;  180033E; 
MINT MINT-2858506;  MINT-3304712;  MINT-49071;  MINT-49243;  MINT-51023;  MINT-7995173;  MINT-7995182;  MINT-7995334; 
HPRD 00010;  00017;  00032;  01417;  01456;  03183;  03229;  03387;  03465;  04078;  04585;  05496;  07601;  08442;  09113;  10584;  14358;  16050;  16246; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:2023
KEGG GENES KEGG GENES(2023)
GeneCard GeneCardENO1*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function phosphopyruvate hydratase activity (GO:0004634);  magnesium ion binding (GO:0000287); 
Biological process glycolysis (GO:0006096); 
Cellular component phosphopyruvate hydratase complex (GO:0000015); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT cytosol;  nuclear; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
3 139 1e9iA2 2e-59 63.7 135/139 d.54.1.1
141 431 1e9iA1 3e-81 48.4 285/291 c.1.11.1
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene NA
Affymetrix
GeneChip
HG-Focus 201231_s_at; 
HG-U133 201231_s_at;  216554_s_at;  217294_s_at; 
HG-U133A 201231_s_at;  216554_s_at;  217294_s_at; 
HG-U133A_2 201231_s_at;  216554_s_at;  217294_s_at; 
HG-U133B NA
HG-U133_Plus_2 201231_s_at;  216554_s_at;  217294_s_at; 
HG-U95 2035_s_at; 
HG-U95A 2035_s_at; 
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 2395503;  2395504;  2395505;  2395507;  2395510;  2395518; 
HuGeneFL M14328_s_at; 
Agilent Human 1A Oligo Microarray:PGID215 NA
Whole Human Genome Oligo Microarray:PGID247 A_24_P105501; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Disease/pathology information  DiseaseInfo Viewer LEGENDA Last modified:27-May-2015
Disease relation Disease name:NA
Related information in OMIM OMIM ID:  172430;  Title: ENOLASE 1
Co-localized orphan diseases NA
Disease related mutation NA
Literature-Extracted GENe-Disease Associations (LEGENDA) LEGENDA Gene name Entrez Gene ID:(2023)
Disease Entrez Gene ID:(2023)
Substance Entrez Gene ID:(2023)
Related H-InvDB links DiseaseInfo ViewerDiseaseInfo ViewerLEGENDALEGENDA

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
44 .. 44 G/T rs11544495 + CDS Nonsynonymous[Arg15Leu]
125 .. 125 G/C rs11544503 + CDS Nonsynonymous[Gly42Ala]
131 .. 131 A/G rs138834005 - CDS Nonsynonymous[Tyr44Cys]
167 .. 167 G/A rs201990176 - CDS Nonsynonymous[Arg56His]
175 .. 175 G/A rs142310173 - CDS Nonsynonymous[Gly59Arg]
201 .. 201 G/A rs28999074 + CDS Synonymous[Glu67Glu]
204 .. 204 C/T rs201513751 - CDS Synonymous[His68His]
209 .. 209 A/G rs201867667 - CDS Nonsynonymous[Asn70Ser]
223 .. 223 C/A rs146938354 - CDS Nonsynonymous[Pro75Thr]
231 .. 231 G/A rs28999075 + CDS Synonymous[Leu77Leu]
232 .. 232 G/T rs146619828 - CDS Nonsynonymous[Val78Phe]
282 .. 282 G/C rs11544491 + CDS Nonsynonymous[Met94Ile]
293 .. 293 A/G rs201943492 - CDS Nonsynonymous[Asp98Gly]
324 .. 324 G/A rs200935067 - CDS Synonymous[Ala108Ala]
352 .. 352 G/A rs199529530 - CDS Nonsynonymous[Val118Ile]
357 .. 357 C/T rs11544507 + CDS Synonymous[Cys119Cys]
370 .. 370 G/A/C rs11544519 + CDS
396 ^ 397 -/CC rs144538182 - CDS
399 .. 399 C/T rs11544497 + CDS Synonymous[His133His]
417 .. 417 C/A rs142256351 - CDS Synonymous[Gly139Gly]
495 .. 495 G/C rs11544509 + CDS Nonsynonymous[Met165Ile]
531 .. 531 C/A/T rs11544513 + CDS
567 .. 567 C/T rs11544499 + CDS Synonymous[Tyr189Tyr]
569 .. 569 A/G rs201627070 - CDS Nonsynonymous[His190Arg]
586 .. 586 A/G rs199771237 - CDS Nonsynonymous[Ile196Val]
634 .. 634 G/A rs201238976 - CDS Nonsynonymous[Gly212Arg]
710 .. 710 C/T rs148752848 - CDS Nonsynonymous[Thr237Ile]
724 .. 724 A/G rs138820314 - CDS Nonsynonymous[Ile242Val]
727 .. 727 G/A rs143707545 - CDS Nonsynonymous[Gly243Ser]
735 .. 735 C/G/T rs2230874 + CDS
740 .. 740 C/T rs201508705 - CDS Nonsynonymous[Ala247Val]
747 .. 747 C/T rs143076849 - CDS Synonymous[Ser249Ser]
748 .. 748 G/C/T rs11544512 + CDS
897 .. 897 T/C rs140944386 - CDS Synonymous[Asp299Asp]
974 .. 974 C/A rs11544514 + CDS Nonsynonymous[Pro325Gln]
975 .. 975 A/C rs140674283 - CDS Synonymous[Pro325Pro]
987 .. 987 C/A rs3180139 + CDS Synonymous[Ala329Ala]
999 .. 999 C/T rs146867004 - CDS Synonymous[Asn333Asn]
1064 .. 1064 A/C rs201636531 - CDS Nonsynonymous[Gln355Pro]
1070 .. 1070 G/A rs200008125 - CDS Nonsynonymous[Cys357Tyr]
1088 .. 1088 A/G rs151047591 - CDS Nonsynonymous[Asn363Ser]
1114 .. 1114 C/T rs150781341 - CDS Nonsynonymous[Arg372Cys]
1118 .. 1118 C/T rs143592223 - CDS Nonsynonymous[Ser373Leu]
1123 .. 1123 G/A rs3206672 + CDS Nonsynonymous[Glu375Lys]
1159 .. 1159 G/C rs11544489 + CDS Nonsynonymous[Gly387Arg]
1208 .. 1208 G/A rs201032262 - CDS Nonsynonymous[Arg403His]
1238 .. 1238 T/C rs201317089 - CDS Nonsynonymous[Ile413Thr]
1248 .. 1248 G/A rs193006639 - CDS Synonymous[Glu416Glu]
1293 .. 1293 C/T rs1065722 + CDS Synonymous[Pro431Pro]
1299 .. 1299 C/A rs139671695 - CDS Synonymous[Ala433Ala]
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer