H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000100400 Accession number: D00422 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Proactivator polypeptide; Contains: Saposin-A; Protein A; Contains: Saposin-B-Val; Contains: Saposin-B; Cerebroside sulfate activator; CSAct; Dispersin; Sphingolipid activator protein 1; SAP-1; Sulfatide/GM1 activator; Contains: Saposin-C; A1 activator; Co-beta-glucosidase; Glucosylceramidase activator; Sphingolipid activator protein 2; SAP-2; Contains: Saposin-D; Component C; Protein C; Precursor;
 
 

Transcript original information
Accession number D00422.1
CAGE tag ID NA
EST ID NA
Clone Number NA
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (PSAP) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (PSAP);
Sequence data provider NA
Annotation project NA
Length of cDNA 2734[bp] (No. of exon:14)[A:587 T:665 G:785 C:697]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type NA
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) CAGAAG;  TAGGAG; 
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0008908
Genomic location  G-integra Help Chromosome 10
Location 10q22.1
Position 73576056- 73610985
Strand -
Possible duplicated location(s) NA
Gene structure 14 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:5660; 
KEGG GENES KEGG GENES(5660); 
GeneCard GeneCardPSAP;  *GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS;  G-integraG-integra;  cDNA-genome alignmentcDNA-genome alignment; 

Predicted CDS information
HIP ID HIP000115884
Predicted CDS 9..1592;  527[aa];  Orientation:+3; 
Codon Adaptation Index (CAI). 0.822
Database links RefSeq NP_001035930; 
UniProt NA
CCDS NA

Motif information
ORF

length(527),orf(9:1592) MYALFLLASLLGAALAGPVLGLKECTRGSAVWCQNVKTASDCGAVKHCLQ TVWNKPTVKSLPCDICKDVVTAAGDMLKDNATEEEILVYLEKTCDWLPKP NMSASCKEIVDSYLPVILDIIKGEMSRPGEVCSALNLCESLQKHLAELNH QKQLESNKIPELDMTEVVAPFMANIPLLLYPQDGPRSKPQPKDNGDVCQD CIQMVTDIQTAVRTNSTFVQALVEHVKEECDRLGPGMADICKNYISQYSE IAIQMMMHMQDQQPKEICALVGFCDEVKEMPMQTLVPAKVASKNVIPALE LVEPIKKHEVPAKSDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCS KLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSGTRLPALT VHVTQPKDGGFCEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDPY QKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIGACPSAHKPLLGTEKCIW GPSYWCQNTETAAQCNAVEHCKRHVWN* 		a.a.
length		 InterPro Name
length(25), motif(18:42) 25 IPR008373 Saposin [Family]
length(41), motif(18:58) 41 IPR003119 Saposin type A [Domain]
length(34), motif(21:54) 34 IPR003119 Saposin type A [Domain]
length(21), motif(47:67) 21 IPR008373 Saposin [Family]
length(81), motif(59:139) 81 IPR011001 Saposin-like [Domain]
length(84), motif(59:142) 84 IPR008139 Saposin B [Domain]
length(82), motif(60:141) 82 IPR011001 Saposin-like [Domain]
length(78), motif(61:138) 78 IPR008139 Saposin B [Domain]
length(38), motif(61:98) 38 IPR007856 Saposin-like type B, 1 [Domain]
length(18), motif(77:94) 18 IPR008373 Saposin [Family]
length(34), motif(105:138) 34 IPR008138 Saposin-like type B, 2 [Domain]
length(19), motif(128:146) 19 IPR008373 Saposin [Family]
length(26), motif(156:181) 26 IPR008373 Saposin [Family]
length(82), motif(194:275) 82 IPR011001 Saposin-like [Domain]
length(85), motif(194:278) 85 IPR008139 Saposin B [Domain]
length(40), motif(195:234) 40 IPR007856 Saposin-like type B, 1 [Domain]
length(79), motif(196:274) 79 IPR008139 Saposin B [Domain]
length(22), motif(197:218) 22 IPR008373 Saposin [Family]
length(22), motif(233:254) 22 IPR008373 Saposin [Family]
length(117), motif(237:353) 117 IPR011001 Saposin-like [Domain]
length(37), motif(238:274) 37 IPR008138 Saposin-like type B, 2 [Domain]
length(80), motif(313:392) 80 IPR011001 Saposin-like [Domain]
length(82), motif(314:395) 82 IPR008139 Saposin B [Domain]
length(76), motif(316:391) 76 IPR008139 Saposin B [Domain]
length(38), motif(316:353) 38 IPR007856 Saposin-like type B, 1 [Domain]
length(21), motif(318:338) 21 IPR008373 Saposin [Family]
length(92), motif(356:447) 92 IPR011001 Saposin-like [Domain]
length(35), motif(357:391) 35 IPR008138 Saposin-like type B, 2 [Domain]
length(19), motif(367:385) 19 IPR008373 Saposin [Family]
length(80), motif(408:487) 80 IPR011001 Saposin-like [Domain]
length(82), motif(408:489) 82 IPR008139 Saposin B [Domain]
length(23), motif(409:431) 23 IPR008373 Saposin [Family]
length(76), motif(410:485) 76 IPR008139 Saposin B [Domain]
length(38), motif(410:447) 38 IPR007856 Saposin-like type B, 1 [Domain]
length(23), motif(441:463) 23 IPR008373 Saposin [Family]
length(78), motif(449:526) 78 IPR011001 Saposin-like [Domain]
length(34), motif(452:485) 34 IPR008138 Saposin-like type B, 2 [Domain]
length(24), motif(463:486) 24 IPR008373 Saposin [Family]
length(37), motif(491:527) 37 IPR003119 Saposin type A [Domain]
length(22), motif(492:513) 22 IPR008373 Saposin [Family]
length(34), motif(494:527) 34 IPR003119 Saposin type A [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000100400
H-Inv cluster ID Locus viewHIX0008908
Accession number D00422.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Proactivator polypeptide; Contains: Saposin-A; Protein A; Contains: Saposin-B-Val; Contains: Saposin-B; Cerebroside sulfate activator; CSAct; Dispersin; Sphingolipid activator protein 1; SAP-1; Sulfatide/GM1 activator; Contains: Saposin-C; A1 activator; Co-beta-glucosidase; Glucosylceramidase activator; Sphingolipid activator protein 2; SAP-2; Contains: Saposin-D; Component C; Protein C; Precursor;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (P07602)  [Identity/coverage = 99.431%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 1371116;  1612590;  1958198;  2013321;  2019586;  2060627;  2209618;  2302219;  2320574;  2498298;  2515150;  2717620;  2825202;  2842863;  2845979;  2868718;  3048308;  3242555;  3442600;  7730378;  7866401;  8323276;  8370464;  10196694;  10406958;  10510427;  10562467;  10682309;  11180632;  11309366;  12510003;  12518053;  15164054;  15489334;  15773042;  17919309;  19159218;  19167329;  21269460;  ALL; 
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol PSAP
HGNC aliases "sphingolipid activator protein-1"
HGNC name prosaposin
DDBJ NA
UniProt PSAP
EC number NA
GGDB
(GlycoGene Database)
 Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000115884
No. of interaction 42
Interaction partner(s) HIP000021398;  HIP000021398;  HIP000021818;  HIP000022671;  HIP000023822;  HIP000025218;  HIP000027358;  HIP000027358;  HIP000027633;  HIP000027819;  HIP000027819;  HIP000028809;  HIP000036277;  HIP000036277;  HIP000043309;  HIP000044974;  HIP000045907;  HIP000045907;  HIP000046272;  HIP000054389;  HIP000060961;  HIP000071861;  HIP000076344;  HIP000090978;  HIP000090978;  HIP000092457;  HIP000094247;  HIP000096658;  HIP000100064;  HIP000100064;  HIP000100089;  HIP000100824;  HIP000105862;  HIP000107528;  HIP000112312;  HIP000112312;  HIP000128077;  HIP000130959;  HIP000137500;  HIP000337035;  HIP000347257;  HIP000357639; 
BIND 149938;  150543;  262675; 
DIP 103975E;  112158E; 
MINT MINT-2866200;  MINT-60928;  MINT-62098;  MINT-63423;  MINT-65660;  MINT-65765;  MINT-6797475;  MINT-6797576;  MINT-6797604;  MINT-6797801; 
HPRD 00291;  01775;  02170;  02971;  03013;  03883;  04484;  05160;  05343;  06973;  07255;  16735; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:5660; 
KEGG GENES KEGG GENES(5660); 
GeneCard GeneCardPSAP;  *GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases; 
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT; 
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
FR ID FR006585
Accession
Description
Location
PMID

Gene ontology information
Biological process sphingolipid metabolic process (GO:0006665);  lipid metabolic process (GO:0006629); 
Cellular component lysosome (GO:0005764); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT plasma membrane;  endoplasmic;  peroxisome;  Other; 
Target P signal peptide
SOSUI membrane protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
63 138 2gtgA1 4e-12 42.1 74/78 a.64.1.1
195 275 1n69A 8e-13 100.0 78/78 a.64.1.3
315 392 2gtgA1 1e-14 79.5 78/78 a.64.1.1
409 486 1nklA 9e-14 19.5 77/78 a.64.1.1
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator		 AceGene AGhsB130712; 
Affymetrix
GeneChip		 HG-Focus NA
HG-U133 200871_s_at; 
HG-U133A 200871_s_at; 
HG-U133A_2 200871_s_at; 
HG-U133B NA
HG-U133_Plus_2 200871_s_at; 
HG-U95 NA
HG-U95A NA
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 3251267;  3251274;  3293763;  3293775;  3293777;  3293779;  3293780;  3293781;  3293782;  3293787;  3293788;  3293789;  3293790;  3293793;  3293794;  3293795;  3293800; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 NA
Whole Human Genome Oligo Microarray:PGID247 A_24_P309317; 
Related H-InvDB links H-ANGELH-ANGEL;  DNAProbeLocatorDNAProbeLocator; 

Disease/pathology information  DiseaseInfo Viewer LEGENDA Last modified:27-May-2015
Disease relation Disease name: Combined SAP deficiency (611721);  Disease name: Gaucher disease, atypical (610539);  Disease name: Krabbe disease, atypical (611722);  Disease name: Metachromatic leukodystrophy due to SAP-b deficiency (249900); 
Related information in OMIM OMIM ID:  176801;  Title: PROSAPOSIN
Co-localized orphan diseases NA
Disease related mutation MutationView:  176801; 
JRE-1.4.0 or later is required.Download JRE at Sun's web site.
Literature-Extracted GENe-Disease Associations (LEGENDA) LEGENDA Gene name Entrez Gene ID:(5660)
Disease Entrez Gene ID:(5660)
Substance Entrez Gene ID:(5660)
Related H-InvDB links DiseaseInfo ViewerDiseaseInfo Viewer;  LEGENDALEGENDA; 

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
5 .. 5 C/T rs2070188 + 5'UTR
9 .. 9 A/T rs121918106 + CDS Nonsynonymous[Met1Leu]
24 .. 24 C/T rs148279196 - CDS Nonsynonymous[Leu6Phe]
44 .. 44 C/G rs11555014 + CDS Synonymous[Gly12Gly]
56 .. 56 C/T rs199808371 - CDS Synonymous[Ala16Ala]
68 .. 68 T/C rs188252882 - CDS Synonymous[Leu20Leu]
75 .. 75 A/G rs143016278 - CDS Nonsynonymous[Lys23Glu]
79 ^ 80 -/A rs34228343 - CDS
86 .. 86 C/T rs74145688 - CDS Synonymous[Thr26Thr]
91 .. 91 G/T rs185057837 - CDS Nonsynonymous[Gly28Val]
96 .. 96 G/T rs144942998 - CDS Nonsynonymous[Ala30Ser]
102 .. 102 T/G rs200008050 - CDS Nonsynonymous[Trp32Gly]
121 .. 121 C/T rs145181011 - CDS Nonsynonymous[Thr38Met]
125 .. 125 G/A rs200836594 - CDS Synonymous[Ala39Ala]
128 .. 128 C/T rs141231601 - CDS Synonymous[Ser40Ser]
155 .. 155 G/A rs112119208 - CDS Synonymous[Leu49Leu]
161 .. 161 C/T rs11555016 + CDS Synonymous[Thr51Thr]
162 .. 162 G/A rs147920923 - CDS Nonsynonymous[Val52Ile]
197 .. 197 C/T rs111369573 - CDS Synonymous[Cys63Cys]
212 .. 212 C/T rs143981174 - CDS Synonymous[Asp68Asp]
222 .. 222 G/A rs150701404 - CDS Nonsynonymous[Ala72Thr]
225 .. 225 G/A rs11555015 + CDS Nonsynonymous[Ala73Thr]
353 .. 353 T/G rs11555017 + CDS Synonymous[Pro115Pro]
366 .. 366 A/G rs142784765 - CDS Nonsynonymous[Ile120Val]
387 .. 387 C/T rs148519599 - CDS Nonsynonymous[Arg127Cys]
496 .. 496 A/T rs146301708 - CDS Nonsynonymous[Asp163Val]
548 .. 548 C/T rs11555021 + CDS Synonymous[Tyr180Tyr]
557 .. 557 C/T rs142002239 - CDS Synonymous[Asp183Asp]
564 .. 564 C/T rs193088462 - CDS Nonsynonymous[Arg186Cys]
565 .. 565 G/A rs138880818 - CDS Nonsynonymous[Arg186His]
573 .. 573 C/T rs188854022 - CDS Nonsynonymous[Pro189Ser]
578 .. 578 G/T rs142272618 - CDS Nonsynonymous[Gln190His]
585 .. 585 G/C rs149305591 - CDS Nonsynonymous[Asp193His]
586 .. 586 A/G rs138636858 - CDS Nonsynonymous[Asp193Gly]
590 .. 590 T/C rs150177878 - CDS Synonymous[Asn194Asn]
597 .. 597 G/A rs191952316 - CDS Nonsynonymous[Val197Ile]
624 .. 624 A/G rs139503658 - CDS Nonsynonymous[Thr206Ala]
629 .. 629 C/T rs140702696 - CDS Synonymous[Asp207Asp]
631 .. 631 T/G rs200319381 - CDS Nonsynonymous[Ile208Ser]
645 .. 645 C/T rs150521779 - CDS Nonsynonymous[Arg213Trp]
651 .. 651 A/C rs121918107 + CDS Nonsynonymous[Asn215His]
658 .. 658 C/T rs121918103 + CDS Nonsynonymous[Thr217Ile]
703 .. 703 G/T rs147265566 - CDS Nonsynonymous[Arg232Leu]
705 .. 705 C/T/G rs146934980 - CDS
722 .. 722 C/G rs141199649 - CDS Synonymous[Ala238Ala]
730 .. 730 G/C rs121918104 + CDS Nonsynonymous[Cys241Ser]
731 .. 731 C/T rs147805036 - CDS Synonymous[Cys241Cys]
740 .. 740 T/C rs146732171 - CDS Synonymous[Tyr244Tyr]
749 .. 749 G/T rs202069470 - CDS Nonsynonymous[Gln247His]
788 .. 788 G/C rs112041816 - CDS Nonsynonymous[Gln260His]
791 .. 791 T/A rs113827790 - CDS Nonsynonymous[Asp261Glu]
815 .. 815 G/A rs199672678 - CDS Synonymous[Ala269Ala]
839 .. 839 G/A rs149202005 - CDS Synonymous[Val277Val]
882 .. 882 T/C rs145404688 - CDS Nonsynonymous[Ser292Pro]
911 .. 911 G/A rs150048951 - CDS Synonymous[Leu301Leu]
931 .. 931 A/G rs113554687 - CDS Nonsynonymous[His308Arg]
957 .. 957 T/C rs202041927 - CDS Nonsynonymous[Tyr317His]
983 .. 983 G/A rs139413990 - CDS Synonymous[Val325Val]
1034 .. 1034 C/T rs146778046 - CDS Synonymous[Leu342Leu]
1037 .. 1037 C/T rs113679008 - CDS Synonymous[Asp343Asp]
1046 .. 1046 C/A rs199650747 - CDS Nonsynonymous[Asp346Glu]
1063 .. 1063 T/C rs121918110 + CDS Nonsynonymous[Leu352Pro]
1066 .. 1066 C/T rs201129306 - CDS Nonsynonymous[Pro353Leu]
1073 .. 1073 C/T rs138328594 - CDS Synonymous[Ser355Ser]
1105 .. 1105 C/T rs140066253 - CDS Nonsynonymous[Thr366Met]
1109 .. 1109 C/T rs200226479 - CDS Synonymous[Tyr367Tyr]
1139 .. 1139 G/A rs146102517 - CDS Synonymous[Glu377Glu]
1161 .. 1161 T/G rs121918108 + CDS Nonsynonymous[Cys385Gly]
1162 .. 1162 G/T rs121918105 + CDS Nonsynonymous[Cys385Phe]
1181 .. 1181 C/T rs141254386 - CDS Synonymous[Cys391Cys]
1189 .. 1189 C/T rs202125074 - CDS Nonsynonymous[Thr394Met]
1244 .. 1244 C/T rs147030327 - CDS Synonymous[Cys412Cys]
1259 .. 1259 G/T rs1803650 + CDS Nonsynonymous[Lys417Asn]
1296 .. 1296 A/G rs148676984 - CDS Nonsynonymous[Ser430Gly]
1299 .. 1299 A/G rs200379457 - CDS Nonsynonymous[Thr431Ala]
1305 .. 1305 C/T rs121918109 + CDS AA-STOP[Gln433*]
1313 .. 1313 C/T rs144042454 - CDS Synonymous[Ile435Ile]
1328 .. 1328 G/A rs149525964 - CDS Synonymous[Glu440Glu]
1355 .. 1355 T/C rs138217875 - CDS Synonymous[Pro449Pro]
1391 .. 1391 C/T rs146925179 - CDS Synonymous[Tyr461Tyr]
1397 .. 1397 C/T rs1049882 + CDS Synonymous[Pro463Pro]
1398 .. 1398 G/A rs138716613 - CDS Nonsynonymous[Val464Met]
1469 .. 1469 G/A rs114389264 - CDS Synonymous[Ser487Ser]
1478 .. 1478 G/A rs140777530 - CDS Synonymous[Lys490Lys]
1493 .. 1493 T/C rs139178900 - CDS Synonymous[Thr495Thr]
1512 .. 1512 C/T rs143773764 - CDS Nonsynonymous[Pro502Ser]
1536 .. 1536 G/C rs149000433 - CDS Nonsynonymous[Glu510Gln]
1608 .. 1608 A/T rs199602243 - 3'UTR
1678 .. 1678 T/C rs187964417 - 3'UTR
1685 .. 1685 T/C rs183945494 - 3'UTR
1706 ^ 1707 -/C rs71480591 - 3'UTR
1709 ^ 1710 -/C rs36076120 - 3'UTR
1712 .. 1712 C/G rs191704547 - 3'UTR
1714 .. 1714 C/G rs113284884 - 3'UTR
1845 .. 1845 G/C rs113209259 - 3'UTR
1857 .. 1857 C/T rs150766866 - 3'UTR
1912 .. 1912 A/T rs14595 - 3'UTR
1968 .. 1968 A/G rs141906397 - 3'UTR
2021 .. 2021 C/G rs11555018 + 3'UTR
2179 .. 2179 G/A rs11555020 + 3'UTR
2191 .. 2191 G/T rs1803651 + 3'UTR
2228 .. 2228 C/T rs138390739 - 3'UTR
2246 .. 2246 G/T rs41282246 - 3'UTR
2329 .. 2329 G/A rs147046509 - 3'UTR
2366 .. 2366 C/T rs200907537 - 3'UTR
2367 .. 2367 G/A rs79662404 - 3'UTR
2388 .. 2388 T/C rs12844 + 3'UTR
2389 .. 2389 A/G rs141553639 - 3'UTR
2439 .. 2439 C/T rs1053333 + 3'UTR
2458 .. 2458 A/C rs1056711 + 3'UTR
2483 .. 2483 G/A/C rs7869 + 3'UTR
2511 .. 2511 G/A rs1054293 + 3'UTR
2526 .. 2526 A/C rs188600883 - 3'UTR
2573 .. 2573 G/A rs1054851 + 3'UTR
2615 .. 2615 C/T rs1055754 + 3'UTR
2677 .. 2677 G/A rs41282244 - 3'UTR
2686 .. 2686 G/T rs10390 + 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD); 
Related H-InvDB links VaryGeneVaryGene;  Repeat mask viewerRepeat Mask Viewer;