H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000101680 Accession number: D63412 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Aquaporin-4; AQP-4; Mercurial-insensitive water channel; MIWC; WCH4;
 
 

Transcript original information
Accession number D63412.1
CAGE tag ID NA
EST ID NA
Clone Number NA
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ;
Sequence data provider NA
Annotation project NA
Length of cDNA 1744[bp] (No. of exon:5)[A:501 T:496 G:385 C:362]
Devision HUM
Molecular type mRNA
Library origin Cell type stomach
Tissue type NA
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0014377
Genomic location  G-integra Help Chromosome 18
Location 18q11.2
Position 24435423- 24445673
Strand -
Possible duplicated location(s) NA
Gene structure 5 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:361
KEGG GENES KEGG GENES(361)
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000096738
Predicted CDS 21..992;  323[aa];  Orientation:+3; 
Codon Adaptation Index (CAI). 0.743
Database links RefSeq NP_001641
UniProt P55087
CCDS CCDS11889

Motif information
ORF

length(323),orf(21:992)
MSDRPTARRWGKCGPLCTRENIMVAFKGVWTQAFWKAVTAEFLAMLIFVL
LSLGSTINWGGTEKPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAV
TVAMVCTRKISIAKSVFYIAAQCLGAIIGAGILYLVTPPSVVGGLGVTMV
HGNLTAGHGLLVELIITFQLVFTIFASCDSKRTDVTGSIALAIGFSVAIG
HLFAINYTGASMNPARSFGPAVIMGNWENHWIYWVGPIIGAVLAGGLYEY
VFCPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVH
VIDVDRGEEKKGKDQSGEVLSSV*
a.a.
length
InterPro Name
length(319), motif(1:319) 319 IPR000425 Major intrinsic protein [Family]
length(231), motif(31:261) 231 IPR023271 Aquaporin-like [Domain]
length(226), motif(31:256) 226 IPR023271 Aquaporin-like [Domain]
length(217), motif(32:248) 217 IPR000425 Major intrinsic protein [Family]
length(20), motif(36:55) 20 IPR000425 Major intrinsic protein [Family]
length(209), motif(40:248) 209 IPR000425 Major intrinsic protein [Family]
length(25), motif(77:101) 25 IPR000425 Major intrinsic protein [Family]
length(9), motif(95:103) 9 IPR022357 Major intrinsic protein, conserved site [Conserved_site]
length(20), motif(114:133) 20 IPR000425 Major intrinsic protein [Family]
length(19), motif(162:180) 19 IPR000425 Major intrinsic protein [Family]
length(23), motif(194:216) 23 IPR000425 Major intrinsic protein [Family]
length(21), motif(231:251) 21 IPR000425 Major intrinsic protein [Family]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000101680
H-Inv cluster ID Locus viewHIX0014377
Accession number D63412.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help Representative H-Inv IDRepresentative transcript;  Splicing isoformSplicing isoform
Coding potential  Help Protein coding; 
Definition Aquaporin-4; AQP-4; Mercurial-insensitive water channel; MIWC; WCH4;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (P55087)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 75594268601457885528115489334161777911938379022328087ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol NA
HGNC aliases NA
HGNC name NA
DDBJ NA
UniProt AQP4
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000096738
No. of interaction 1
Interaction partner(s) HIP000092670
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:361
KEGG GENES KEGG GENES(361)
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Human curated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function transporter activity (GO:0005215); 
Biological process transport (GO:0006810); 
Cellular component membrane (GO:0016020); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT plasma membrane; 
Target P signal peptide
SOSUI membrane protein
TMHMM membrane protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
89 228 1j4nA 2e-07 17.9 140/249 f.19.1.1
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsA010410; 
Affymetrix
GeneChip
HG-Focus 210067_at; 
HG-U133 210066_s_at;  210067_at;  210068_s_at;  210906_x_at; 
HG-U133A 210066_s_at;  210067_at;  210068_s_at;  210906_x_at; 
HG-U133A_2 210066_s_at;  210067_at;  210068_s_at;  210906_x_at; 
HG-U133B NA
HG-U133_Plus_2 210066_s_at;  210067_at;  210068_s_at;  210906_x_at; 
HG-U95 40793_s_at; 
HG-U95A 40793_s_at; 
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 3782848;  3802402;  3802403;  3802404;  3802406;  3802407;  3802409;  3802410;  3802414; 
HuGeneFL D63412_at; 
Agilent Human 1A Oligo Microarray:PGID215 A_23_P107565;  A_23_P252041; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P107565; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Evolutionary information  Evola Help Last modified:27-May-2015
Relationship Species Accession number MGI Links
Orthology Bos sp. (Cow) AB015947 G-integraG-integra
Orthology Gallus sp. (Chicken) AB190358 G-integraG-integra
Orthology Danio sp. (Zebrafish) BC078213 G-integraG-integra
Orthology Tetraodon sp. (Tetraodon) CR661334 G-integraG-integra
Orthology Macaca sp. (Macaque) ENSMMUT00000020942 G-integraG-integra
Orthology Mus sp. (Mouse) ENSMUST00000079081 G-integraG-integra
Orthology Oryzias sp. (Medaka) ENSORLT00000021288 G-integraG-integra
Orthology Pongo sp. (Orangutan) ENSPPYT00000010597 G-integraG-integra
Orthology Pan sp. (Chimpanzee) ENSPTRT00000056675 G-integraG-integra
Orthology Takifugu sp. (Fugu) SINFRUT00000162705 G-integraG-integra
Orthology Rattus sp. (Rat) U14007 G-integraG-integra
Orthology Monodelphis sp. (Opossum) XM_001363548 G-integraG-integra
Orthology Equus sp. (Horse) XM_001494280 G-integraG-integra
Orthology Canis sp. (Dog) XM_850363 G-integraG-integra
Phylogenetic tree [View by ATV]
Neighbor-joining (phb) 
Related H-InvDB links EvolaEvoladN/dS (under constraction); 

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
47 .. 47 G/T rs190801689 - CDS Synonymous[Arg9Arg]
63 .. 63 C/A rs199674181 - CDS Nonsynonymous[Pro15Thr]
76 .. 76 G/C rs150587304 - CDS Nonsynonymous[Arg19Thr]
100 .. 100 A/G rs141793428 - CDS Nonsynonymous[Lys27Arg]
120 .. 120 T/C rs201354429 - CDS Nonsynonymous[Phe34Leu]
139 .. 139 C/T rs200221507 - CDS Nonsynonymous[Ala40Val]
159 .. 159 A/C rs201582782 - CDS Nonsynonymous[Ile47Leu]
170 .. 170 C/T rs201758586 - CDS Synonymous[Leu50Leu]
173 .. 173 C/T rs148022306 - CDS Synonymous[Leu51Leu]
177 .. 177 C/T rs55839024 - CDS Synonymous[Leu53Leu]
178 .. 178 T/G rs55946817 - CDS Nonsynonymous[Leu53Arg]
199 .. 199 G/A rs200232760 - CDS Nonsynonymous[Gly60Asp]
221 .. 221 T/G rs35248760 - CDS Synonymous[Pro67Pro]
378 .. 378 G/C rs140271115 - CDS Nonsynonymous[Ala120Pro]
386 .. 386 G/A rs72557968 + CDS Synonymous[Gln122Gln]
401 .. 401 C/A rs144702688 - CDS Synonymous[Ile127Ile]
403 .. 403 T/C rs61731042 - CDS Nonsynonymous[Ile128Thr]
407 .. 407 A/G rs144914209 - CDS Synonymous[Gly129Gly]
426 .. 426 G/T rs200102632 - CDS Nonsynonymous[Val136Phe]
466 .. 466 T/C rs202114851 - CDS Nonsynonymous[Met149Thr]
500 .. 500 C/A rs150051046 - CDS Synonymous[Leu160Leu]
512 .. 512 G/A rs1839318 - CDS Synonymous[Leu164Leu]
564 .. 564 C/T rs151292719 - CDS Nonsynonymous[Arg182Trp]
565 .. 565 G/A rs187543361 - CDS Nonsynonymous[Arg182Gln]
572 .. 572 T/A rs61731038 - CDS Nonsynonymous[Asp184Glu]
586 .. 586 T/C rs140954190 - CDS Nonsynonymous[Ile189Thr]
598 .. 598 T/C rs61731037 - CDS Nonsynonymous[Ile193Thr]
609 .. 609 G/A rs145495511 - CDS Nonsynonymous[Val197Ile]
633 .. 633 A/C rs72557974 + CDS Nonsynonymous[Ile205Leu]
663 .. 663 G/A rs148498248 - CDS Nonsynonymous[Ala215Thr]
691 .. 691 T/C rs72557975 + CDS Nonsynonymous[Met224Thr]
710 .. 710 T/C rs72557976 + CDS Synonymous[His230His]
745 .. 745 T/C rs200115882 - CDS Nonsynonymous[Val242Ala]
754 .. 754 G/C rs201162228 - CDS Nonsynonymous[Gly245Ala]
798 .. 798 C/T rs201862553 - CDS Nonsynonymous[Arg260Cys]
802 .. 802 G/A rs149529726 - CDS Nonsynonymous[Arg261His]
814 .. 814 C/A rs200121613 - CDS Nonsynonymous[Ala265Asp]
839 .. 839 A/G rs72557972 + CDS Synonymous[Thr273Thr]
853 .. 853 T/C rs3906956 - CDS Nonsynonymous[Met278Thr]
856 .. 856 A/C rs199882615 - CDS Nonsynonymous[Glu279Ala]
914 .. 914 G/A rs73396660 - CDS Synonymous[Val298Val]
920 .. 920 T/A rs141721622 - CDS Nonsynonymous[His300Gln]
939 .. 939 G/A rs138721762 - CDS Nonsynonymous[Gly307Arg]
975 .. 975 G/A rs200498749 - CDS Nonsynonymous[Val319Ile]
1115 .. 1115 T/C rs145725871 - 3'UTR
1209 .. 1209 A/T rs9944962 - 3'UTR
1211 .. 1211 G/A rs1058423 + 3'UTR
1212 .. 1212 A/C rs72557977 + 3'UTR
1227 .. 1227 T/C rs187447118 - 3'UTR
1237 .. 1237 T/C rs9807747 - 3'UTR
1275 .. 1275 C/T rs72557978 + 3'UTR
1296 .. 1296 G/C rs72557979 + 3'UTR
1349 .. 1349 G/A rs3763043 + 3'UTR
1490 .. 1490 T/C rs142398969 - 3'UTR
1580 .. 1580 T/G rs335929 - 3'UTR
1622 .. 1622 T/A rs1058424 + 3'UTR
1642 ^ 1643 -/T rs35670019 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene;  Repeat mask viewerRepeat Mask Viewer