H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000101680 Accession number: D63412 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Aquaporin-4; AQP-4; Mercurial-insensitive water channel; MIWC; WCH4;
 
 

Motif information
ORF

length(323),orf(21:992)
MSDRPTARRWGKCGPLCTRENIMVAFKGVWTQAFWKAVTAEFLAMLIFVL
LSLGSTINWGGTEKPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAV
TVAMVCTRKISIAKSVFYIAAQCLGAIIGAGILYLVTPPSVVGGLGVTMV
HGNLTAGHGLLVELIITFQLVFTIFASCDSKRTDVTGSIALAIGFSVAIG
HLFAINYTGASMNPARSFGPAVIMGNWENHWIYWVGPIIGAVLAGGLYEY
VFCPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVH
VIDVDRGEEKKGKDQSGEVLSSV*
a.a.
length
InterPro Name
length(319), motif(1:319) 319 IPR000425 Major intrinsic protein [Family]
length(231), motif(31:261) 231 IPR023271 Aquaporin-like [Domain]
length(226), motif(31:256) 226 IPR023271 Aquaporin-like [Domain]
length(217), motif(32:248) 217 IPR000425 Major intrinsic protein [Family]
length(20), motif(36:55) 20 IPR000425 Major intrinsic protein [Family]
length(209), motif(40:248) 209 IPR000425 Major intrinsic protein [Family]
length(25), motif(77:101) 25 IPR000425 Major intrinsic protein [Family]
length(9), motif(95:103) 9 IPR022357 Major intrinsic protein, conserved site [Conserved_site]
length(20), motif(114:133) 20 IPR000425 Major intrinsic protein [Family]
length(19), motif(162:180) 19 IPR000425 Major intrinsic protein [Family]
length(23), motif(194:216) 23 IPR000425 Major intrinsic protein [Family]
length(21), motif(231:251) 21 IPR000425 Major intrinsic protein [Family]