H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000191236 Accession number: J04102 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Protein C-ets-2;
 
 

Transcript original information
Accession number J04102.1
CAGE tag ID NA
EST ID NA
Clone Number NA
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ;
Sequence data provider NA
Annotation project NA
Length of cDNA 2269[bp] (No. of exon:10)[A:550 T:492 G:584 C:643]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type NA
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0016112
Genomic location  G-integra Help Chromosome 21
Location 21q22.2
Position 40177755- 40195380
Strand +
Possible duplicated location(s) NA
Gene structure 10 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:2114; 
KEGG GENES KEGG GENES(2114); 
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS;  G-integraG-integra;  cDNA-genome alignmentcDNA-genome alignment; 

Predicted CDS information
HIP ID HIP000079395
Predicted CDS 292..1701;  469[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.801
Database links RefSeq NP_005230; 
UniProt P15036; 
CCDS CCDS13659; 

Motif information
ORF

length(469),orf(292:1701) MNDFGIKNMDQVAPVANSYRGTLKRQPAFDTFDGSLFAVFPSLNEEQTLQ EVPTGLDSISHDSANCELPLLTPCSKAVMSQALKATFSGFKKEQRRLGIP KNPWLWSEQQVCQWLLWATNEFSLVNVNLQRFGMNGQMLCNLGKERFLEL APDFVGDILWEHLEQMIKENQEKTEDQYEENSHLTSVPHWINSNTLGFGT EQAPYGMQTQNYPKGGLLDSMCPASTPSVLSSEQEFQMFPKSRLSSVSVT YCSVSQDFPGSNLNLLTNNSGTPKDHDSPENGADSFESSDSLLQSWNSQS SLLDVQRVPSFESFEDDCSQSLCLNKPTMSFKDYIQERSDPVEQGKPVIP AAVLAGFTGSGPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVA RRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVCDLQNLL GFTPEELHAILGVQPDTED* 		a.a.
length		 InterPro Name
length(102), motif(66:167) 102 IPR013761 Sterile alpha motif/pointed domain [Domain]
length(90), motif(81:170) 90 IPR013761 Sterile alpha motif/pointed domain [Domain]
length(86), motif(85:170) 86 IPR003118 Pointed domain [Domain]
length(84), motif(87:170) 84 IPR003118 Pointed domain [Domain]
length(82), motif(88:169) 82 IPR003118 Pointed domain [Domain]
length(121), motif(346:466) 121 IPR011991 Winged helix-turn-helix DNA-binding domain [Domain]
length(86), motif(362:447) 86 IPR000418 Ets domain [Domain]
length(14), motif(363:376) 14 IPR000418 Ets domain [Domain]
length(82), motif(363:444) 82 IPR000418 Ets domain [Domain]
length(81), motif(363:443) 81 IPR000418 Ets domain [Domain]
length(9), motif(365:373) 9 IPR000418 Ets domain [Domain]
length(19), motif(387:405) 19 IPR000418 Ets domain [Domain]
length(19), motif(406:424) 19 IPR000418 Ets domain [Domain]
length(16), motif(409:424) 16 IPR000418 Ets domain [Domain]
length(19), motif(425:443) 19 IPR000418 Ets domain [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000191236
H-Inv cluster ID Locus viewHIX0016112
Accession number J04102.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Protein C-ets-2;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (P15036)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 2250910;  2847145;  2997781;  10830953;  14702039;  15489334;  18691976;  ALL; 
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol NA
HGNC aliases NA
HGNC name NA
DDBJ ETS2
UniProt ETS2
EC number NA
GGDB
(GlycoGene Database)
 Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000079395
No. of interaction 37
Interaction partner(s) HIP000021733;  HIP000022129;  HIP000022526;  HIP000023055;  HIP000026585;  HIP000027524;  HIP000028809;  HIP000033301;  HIP000036732;  HIP000041711;  HIP000043673;  HIP000048613;  HIP000056841;  HIP000068104;  HIP000078885;  HIP000081026;  HIP000081455;  HIP000087835;  HIP000093084;  HIP000094122;  HIP000096367;  HIP000100939;  HIP000100939;  HIP000105122;  HIP000109256;  HIP000110646;  HIP000116713;  HIP000116926;  HIP000136553;  HIP000144372;  HIP000147100;  HIP000164074;  HIP000256202;  HIP000258478;  HIP000336432;  HIP000355042;  HIP000361205; 
BIND 150478;  197039;  258588;  258815;  258819; 
DIP NA
MINT MINT-62043; 
HPRD 00572;  00679;  01252;  01260;  01298;  01302;  01819;  02534;  02911;  03374;  04078;  04459;  04588;  05037;  05771;  09616;  09830; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:2114; 
KEGG GENES KEGG GENES(2114); 
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases; 
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT; 
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function sequence-specific DNA binding (GO:0043565);  transcription factor activity (GO:0003700); 
Biological process regulation of transcription, DNA-dependent (GO:0006355); 
Cellular component nucleus (GO:0005634); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT nuclear; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
77 166 1sxeA 1e-16 33.3 90/97 a.60.1.1
361 445 1bc7C 2e-30 56.5 85/93 a.4.5.21
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator		 AceGene AGhsA130124; 
Affymetrix
GeneChip		 HG-Focus 201329_s_at; 
HG-U133 201329_s_at; 
HG-U133A 201329_s_at; 
HG-U133A_2 201329_s_at; 
HG-U133B NA
HG-U133_Plus_2 201329_s_at; 
HG-U95 1519_at; 
HG-U95A 1519_at; 
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 3921084;  3921085;  3921093;  3921098;  3921100;  3921101;  3921102;  3921105;  3921107;  3921108;  3921109;  3921112;  3921115;  3921116;  3931970; 
HuGeneFL J04102_at; 
Agilent Human 1A Oligo Microarray:PGID215 NA
Whole Human Genome Oligo Microarray:PGID247 A_24_P382661; 
Related H-InvDB links H-ANGELH-ANGEL;  DNAProbeLocatorDNAProbeLocator; 

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
11 .. 11 C/T rs138866678 + 5'UTR
289 .. 289 A/G rs185407591 + 5'UTR
290 .. 290 G/C rs190801053 + 5'UTR
334 .. 334 G/A rs115148137 + CDS Nonsynonymous[Val15Met]
341 .. 341 A/G rs150592938 + CDS Nonsynonymous[Asn17Ser]
364 .. 364 C/T rs139909964 + CDS Nonsynonymous[Arg25Cys]
371 .. 371 C/T rs143407258 + CDS Nonsynonymous[Pro27Leu]
407 ^ 408 -/T rs66473060 + CDS
480 .. 480 C/T rs184634189 + CDS Synonymous[Ser63Ser]
481 .. 481 G/A rs34373350 - CDS Nonsynonymous[Ala64Thr]
510 .. 510 G/A rs139241184 + CDS Synonymous[Pro73Pro]
534 .. 534 A/G rs11700777 + CDS Synonymous[Gln81Gln]
553 .. 553 A/C rs144867115 + CDS Nonsynonymous[Ser88Arg]
563 .. 563 A/G rs114481523 + CDS Nonsynonymous[Lys91Arg]
575 .. 575 G/A rs149038175 + CDS Nonsynonymous[Arg95Gln]
637 .. 637 C/T rs78391361 + CDS Nonsynonymous[Leu116Phe]
650 .. 650 A/G rs201321686 + CDS Nonsynonymous[Asn120Ser]
687 .. 687 C/T rs142958770 + CDS Synonymous[Phe132Phe]
688 .. 688 G/A rs201897945 + CDS Nonsynonymous[Gly133Ser]
725 .. 725 A/T rs1803557 + CDS Nonsynonymous[Glu145Val]
739 .. 739 C/T rs147754962 + CDS Synonymous[Leu150Leu]
753 .. 753 T/A rs142517222 + CDS Nonsynonymous[Phe154Leu]
786 ^ 787 -/C rs34472454 + CDS
900 .. 900 G/T rs200961208 + CDS Synonymous[Ala203Ala]
930 .. 930 C/G rs200893699 + CDS Synonymous[Pro213Pro]
937 .. 937 G/A rs115908228 + CDS Nonsynonymous[Gly216Ser]
940 .. 940 C/A rs61735785 + CDS Nonsynonymous[Leu217Ile]
944 .. 944 T/G rs114460001 + CDS Nonsynonymous[Leu218Arg]
956 .. 956 G/T rs115297166 + CDS Nonsynonymous[Cys222Phe]
959 .. 959 C/T rs114562289 + CDS Nonsynonymous[Pro223Leu]
975 .. 975 C/T rs115786160 + CDS Synonymous[Ser228Ser]
1018 .. 1018 C/T rs150430243 + CDS Nonsynonymous[Arg243Trp]
1030 .. 1030 G/A rs138127643 + CDS Nonsynonymous[Val247Ile]
1036 .. 1036 G/A rs116698978 + CDS Nonsynonymous[Val249Ile]
1107 .. 1107 T/G rs457705 + CDS Synonymous[Thr272Thr]
1134 .. 1134 C/T rs201143455 + CDS Synonymous[Asn281Asn]
1139 .. 1139 C/T rs138783369 + CDS Nonsynonymous[Ala283Val]
1140 .. 1140 G/A rs115426813 + CDS Synonymous[Ala283Ala]
1187 .. 1187 A/C rs146230611 + CDS Nonsynonymous[Gln299Pro]
1224 .. 1224 C/T rs113417859 + CDS Synonymous[Phe311Phe]
1233 .. 1233 C/T rs201065633 + CDS Synonymous[Phe314Phe]
1255 .. 1255 C/G rs201705823 + CDS Nonsynonymous[Leu322Val]
1313 .. 1313 C/T rs139305338 + CDS Nonsynonymous[Pro341Leu]
1314 .. 1314 A/G rs461155 + CDS Synonymous[Pro341Pro]
1326 ^ 1327 -/C rs34120017 + CDS
1348 .. 1348 G/A rs116771448 + CDS Nonsynonymous[Val353Met]
1453 .. 1453 G/A rs116387099 + CDS Nonsynonymous[Gly388Arg]
1470 .. 1470 C/T rs116476013 + CDS Synonymous[Leu393Leu]
1473 .. 1473 C/T rs185172042 + CDS Synonymous[Ala394Ala]
1474 .. 1474 G/A rs115880316 + CDS Nonsynonymous[Asp395Asn]
1520 .. 1520 C/T rs200586471 + CDS Nonsynonymous[Pro410Leu]
1590 .. 1590 G/A rs139455779 + CDS Synonymous[Thr433Thr]
1653 .. 1653 C/T rs149674474 + CDS Synonymous[Pro454Pro]
1657 .. 1657 G/A rs147744979 + CDS Nonsynonymous[Glu456Lys]
1675 .. 1675 G/A rs142665354 + CDS Nonsynonymous[Gly462Ser]
1679 .. 1679 T/C rs144935329 + CDS Nonsynonymous[Val463Ala]
1686 .. 1686 C/A rs17854245 + CDS Synonymous[Pro465Pro]
1793 .. 1793 A/T rs77488352 + 3'UTR
1842 .. 1842 A/C rs75261542 + 3'UTR
1906 .. 1906 C/T rs188181785 + 3'UTR
1948 .. 1948 G/A rs711 + 3'UTR
2050 .. 2050 T/C rs200475079 + 3'UTR
2112 .. 2112 G/A rs141493936 + 3'UTR
2166 .. 2166 A/T rs530 - 3'UTR
2172 .. 2172 C/T rs8133034 + 3'UTR
2182 .. 2182 T/G rs71316657 + 3'UTR
2232 .. 2232 T/A rs147035130 + 3'UTR
2255 .. 2255 T/C rs41276544 + 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD); 
Related H-InvDB links VaryGeneVaryGene;  Repeat mask viewerRepeat Mask Viewer;