H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000195810 Accession number: M55671 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Vitamin K-dependent protein Z isoform 1 precursor.
 
 

Transcript original information
Accession number M55671.1
CAGE tag ID NA
EST ID NA
Clone Number NA
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (PROZ) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (PROZ);
Sequence data provider NA
Annotation project NA
Length of cDNA 1551[bp] (No. of exon:9)[A:390 T:316 G:426 C:419]
Devision HUM
Molecular type mRNA
Library origin Cell type Hep G-2
Tissue type liver
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0037352
Genomic location  G-integra Help Chromosome 13
Location 13q34
Position 113812968- 113826694
Strand +
Possible duplicated location(s) NA
Gene structure 9 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:8858
KEGG GENES KEGG GENES(8858)
GeneCard GeneCardPROZ*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000027156
Predicted CDS 8..1276;  422[aa];  Orientation:+2; 
Codon Adaptation Index (CAI). 0.765
Database links RefSeq NP_001243063
UniProt NA
CCDS CCDS58300

Motif information
ORF

length(422),orf(8:1276)
MAGCVPLLQGLVLVLALHRVEPSATSLKERHGLHSDSACTGVQESLFLPA
SKANDVLVRWKRAGSYLLEELFEGNLEKECYEEICVYEEAREVFENEVVT
DEFWRRYKGGSPCISQPCLHNGSCQDSIWGYTCTCSPGYEGSNCELAKNE
CHPERTDGCQHFCLPGQESYTCSCAQGYRLGEDHKQCVPHDQCACGVLTS
EKRAPDLQDLPWQVKLTNSEGKDFCGGVIIRENFVLTTAKCSLLHRNITV
KTYFNRTSQDPLMIKITHVHVHMRYDADAGENDLSLLELEWPIQCPGAGL
PVCTPEKDFAEHLLIPRTRGLLSGWARNGTDLGNSLTTRPVTLVEGEECG
QVLNVTVTTRTYCERSSVAAMHWMDGSVVTREHRGSWFLTGVLGSQPVGG
QAHMVLVTKVSRYSLWFKQIMN*
a.a.
length
InterPro Name
length(65), motif(44:108) 65 IPR000294 Gamma-carboxyglutamic acid-rich (GLA) domain [Domain]
length(47), motif(63:109) 47 IPR000294 Gamma-carboxyglutamic acid-rich (GLA) domain [Domain]
length(44), motif(65:108) 44 IPR017857 Coagulation factor, subgroup, Gla domain [Domain]
length(62), motif(65:126) 62 IPR000294 Gamma-carboxyglutamic acid-rich (GLA) domain [Domain]
length(14), motif(67:80) 14 IPR000294 Gamma-carboxyglutamic acid-rich (GLA) domain [Domain]
length(42), motif(68:109) 42 IPR000294 Gamma-carboxyglutamic acid-rich (GLA) domain [Domain]
length(26), motif(79:104) 26 IPR000294 Gamma-carboxyglutamic acid-rich (GLA) domain [Domain]
length(14), motif(81:94) 14 IPR000294 Gamma-carboxyglutamic acid-rich (GLA) domain [Domain]
length(15), motif(95:109) 15 IPR000294 Gamma-carboxyglutamic acid-rich (GLA) domain [Domain]
length(37), motif(109:145) 37 IPR000742 Epidermal growth factor-like domain [Domain]
length(34), motif(112:145) 34 IPR000742 Epidermal growth factor-like domain [Domain]
length(29), motif(115:143) 29 IPR000742 Epidermal growth factor-like domain [Domain]
length(12), motif(124:135) 12 IPR000152 EGF-type aspartate/asparagine hydroxylation site [PTM]
length(12), motif(133:144) 12 IPR013032 EGF-like, conserved site [Conserved_site]
length(39), motif(150:188) 39 IPR000742 Epidermal growth factor-like domain [Domain]
length(264), motif(159:422) 264 IPR009003 Trypsin-like cysteine/serine peptidase domain [Domain]
length(16), motif(172:187) 16 IPR013032 EGF-like, conserved site [Conserved_site]
length(226), motif(197:422) 226 IPR001254 Peptidase S1 [Domain]
length(220), motif(198:417) 220 IPR001254 Peptidase S1 [Domain]
length(209), motif(208:416) 209 IPR001254 Peptidase S1 [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000195810
H-Inv cluster ID Locus viewHIX0037352
Accession number M55671.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help Representative H-Inv IDRepresentative transcript;  Splicing isoformSplicing isoform
Coding potential  Help Protein coding; 
Definition Similar to Vitamin K-dependent protein Z isoform 1 precursor.
Similarity category  Help Category: Similar to known protein(Category II).
Similar to known protein (NP_001243063)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens protein.
Experimental evidence Protein evidence
PubMed ID NA
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol PROZ
HGNC aliases NA
HGNC name protein Z, vitamin K-dependent plasma glycoprotein
DDBJ human protein Z
UniProt NA
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000027156
No. of interaction NA
Interaction partner(s) NA
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:8858
KEGG GENES KEGG GENES(8858)
GeneCard GeneCardPROZ*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Human curated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function calcium ion binding (GO:0005509);  protein binding (GO:0005515);  serine-type endopeptidase activity (GO:0004252); 
Biological process proteolysis (GO:0006508); 
Cellular component extracellular region (GO:0005576); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT extracellular;  cytosol;  peroxisome;  Other; 
Target P signal peptide
SOSUI membrane protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
63 107 1danL3 7e-09 31.8 44/48 g.32.1.1
111 152 1ivoC 1e-08 28.6 42/47 g.3.11.1
132 392 1bglA4 6e-13 6.0 252/293 b.30.5.1
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL liver; 
Probe
information DNAProbeLocator
AceGene AGhsA170220; 
Affymetrix
GeneChip
HG-Focus 208034_s_at; 
HG-U133 208034_s_at; 
HG-U133A 208034_s_at; 
HG-U133A_2 208034_s_at; 
HG-U133B NA
HG-U133_Plus_2 208034_s_at; 
HG-U95 37109_at; 
HG-U95A 37109_at; 
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 3502477;  3502479;  3502480;  3502482;  3502483;  3502485;  3502488;  3502490;  3502491;  3502492;  3502493;  3502494;  3526373;  3526375; 
HuGeneFL M55671_at; 
Agilent Human 1A Oligo Microarray:PGID215 A_23_P140082; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P140074; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
20 .. 20 G/A rs200554473 + CDS Nonsynonymous[Val5Ile]
33 .. 33 A/T rs199716055 + CDS Nonsynonymous[Gln9Leu]
38 .. 38 C/G rs148527063 + CDS Nonsynonymous[Leu11Val]
43 .. 43 C/T rs142938221 + CDS Synonymous[Val12Val]
55 .. 55 C/T rs150663126 + CDS Synonymous[Ala16Ala]
77 .. 77 G/A rs1885956 + CDS Nonsynonymous[Ala24Thr]
130 .. 130 C/T rs117488806 + CDS Synonymous[Gly41Gly]
153 .. 153 C/T rs201823929 + CDS Nonsynonymous[Pro49Leu]
169 .. 169 C/T rs140203873 + CDS Synonymous[Asn54Asn]
173 .. 173 G/A rs143900275 + CDS Nonsynonymous[Val56Ile]
192 .. 192 G/A rs200021724 + CDS Nonsynonymous[Arg62His]
258 .. 258 T/A rs146864768 + CDS Nonsynonymous[Ile84Asn]
268 .. 268 T/A rs140812852 + CDS AA-STOP[Tyr87*]
281 .. 281 G/A rs3024778 + CDS Nonsynonymous[Glu92Lys]
306 .. 306 C/G rs79203568 + CDS Nonsynonymous[Thr100Ser]
316 .. 316 C/T rs201055839 + CDS Synonymous[Phe103Phe]
328 .. 328 T/C rs3024723 + CDS Synonymous[Tyr107Tyr]
335 .. 335 G/A rs199755961 + CDS Nonsynonymous[Gly110Ser]
342 .. 342 C/G rs145523497 + CDS Nonsynonymous[Pro112Arg]
353 .. 353 C/T rs111856642 + CDS AA-STOP[Gln116*]
371 .. 371 G/A rs148844137 + CDS Nonsynonymous[Gly122Ser]
418 .. 418 C/T rs186968607 + CDS Synonymous[Pro137Pro]
520 .. 520 G/A rs564081 + CDS Synonymous[Thr171Thr]
522 .. 522 G/C rs199965278 + CDS Nonsynonymous[Cys172Ser]
528 .. 528 G/A rs148031677 + CDS Nonsynonymous[Cys174Tyr]
592 .. 592 C/A rs183762960 + CDS AA-STOP[Cys195*]
610 .. 610 G/C rs201874723 + CDS Nonsynonymous[Glu201Asp]
614 .. 614 C/T rs142314013 + CDS Nonsynonymous[Arg203Cys]
640 .. 640 G/A rs146163809 + CDS Synonymous[Pro211Pro]
662 .. 662 T/C rs138885452 + CDS Nonsynonymous[Ser219Pro]
665 .. 665 G/A rs143024570 + CDS Nonsynonymous[Glu220Lys]
720 .. 720 C/T rs200554916 + CDS Nonsynonymous[Thr238Ile]
745 .. 745 G/A rs150819115 + CDS Synonymous[Arg246Arg]
767 .. 767 T/G rs138237894 + CDS Nonsynonymous[Phe254Val]
778 .. 778 G/A rs149586261 + CDS Synonymous[Thr257Thr]
782 .. 782 C/A rs144364121 + CDS Nonsynonymous[Gln259Lys]
811 .. 811 C/T rs200261240 + CDS Synonymous[His268His]
812 .. 812 G/A rs140132416 + CDS Nonsynonymous[Val269Ile]
823 .. 823 C/G rs199523691 + CDS Nonsynonymous[His272Gln]
827 .. 827 C/T rs143760342 + CDS Nonsynonymous[Arg274Trp]
828 .. 828 G/A rs141140968 + CDS Nonsynonymous[Arg274Gln]
838 .. 838 G/A rs201042447 + CDS Synonymous[Ala277Ala]
842 .. 842 G/A rs189464617 + CDS Nonsynonymous[Ala279Thr]
849 .. 849 A/T rs146398692 + CDS Nonsynonymous[Glu281Val]
897 .. 897 G/A rs139742813 + CDS Nonsynonymous[Gly297Asp]
935 .. 935 G/A rs199645640 + CDS Nonsynonymous[Ala310Thr]
940 .. 940 G/A rs142075303 + CDS Synonymous[Glu311Glu]
944 .. 944 C/T rs114412052 + CDS Nonsynonymous[Leu313Phe]
947 .. 947 C/T rs140236962 + CDS Nonsynonymous[Leu314Phe]
956 .. 956 C/T rs149903852 + CDS Nonsynonymous[Arg317Cys]
957 .. 957 G/A rs3024772 + CDS Nonsynonymous[Arg317His]
973 .. 973 C/T rs74115810 + CDS Synonymous[Leu322Leu]
976 .. 976 C/T rs3024773 + CDS Synonymous[Ser323Ser]
986 .. 986 C/T rs200894631 + CDS Nonsynonymous[Arg327Cys]
1020 .. 1020 C/T rs200473651 + CDS Nonsynonymous[Thr338Met]
1021 .. 1021 G/A rs3024774 + CDS Synonymous[Thr338Thr]
1084 .. 1084 C/T rs139164186 + CDS Synonymous[Thr359Thr]
1126 .. 1126 G/C rs147857980 + CDS Nonsynonymous[Trp373Cys]
1191 .. 1191 C/T rs141423743 + CDS Nonsynonymous[Ser395Leu]
1233 .. 1233 A/G rs143678466 + CDS Nonsynonymous[Lys409Arg]
1262 .. 1262 C/G rs202097128 + CDS Nonsynonymous[Gln419Glu]
1311 .. 1311 C/T rs3024775 + 3'UTR
1350 .. 1350 G/A rs190663977 + 3'UTR
1509 .. 1509 A/G rs45613935 + 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene;  Repeat mask viewerRepeat Mask Viewer