H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000243594 Accession number: AF486421 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Beta-adducin isoform f.
 
 

Motif information
ORF

length(279),orf(38:876)
MSEETVPEAASPPPPQGQPYFDRFSEDDPEYMRLRNRAADLRQDFNLMEQ
KKRVTMILQSPSFREELEGLIQEQMKKGNNSSNIWALRQIADFMASTSHA
VFPTSSMNVSMMTPINDLHTADSLNLAKGERLMRCKISSVYRLLDLYGWA
QLSDTYVTLRVSKEQDHFLISPKGVSCSEVTASSLIKEVLEMRNKIREQN
RQDVKSAGPQSQLLASVIAEKSRSPSTESQLMSKGDEDTKDDSEETVPNP
FSQLTDQELEEYKKEVERKKLELDETGQE
a.a.
length
InterPro Name
length(187), motif(1:187) 187 IPR027773 Beta-adducin [Family]
length(62), motif(130:191) 62 IPR001303 Class II aldolase/adducin N-terminal [Domain]
length(58), motif(130:187) 58 IPR001303 Class II aldolase/adducin N-terminal [Domain]
length(63), motif(136:198) 63 IPR001303 Class II aldolase/adducin N-terminal [Domain]