H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000245490 Accession number: AJ242910 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: N-acetyl-D-glucosamine kinase; N-acetylglucosamine kinase; EC=2.7.1.59; GlcNAc kinase;
 
 

Motif information
ORF

length(344),orf(18:1052)
MAAIYGGVEGGGTRSEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERIN
EMVNRAKRKAGVDPLVPLRILGLSLSGGDQEDAGRILIEELRDRFPYLSE
SYLITTDAAGSIATATPDGGIVLISGTGSNCRLINPDGSESGCGGWGHMM
GDEGSAYWIAHQAVKIVFDSIDNLEAAPHDIGYVKQAMFHYFQVPDRLGI
LTHLYRDFDKCRFAGFCRKIAEGAQQGDPLSRYIFRKAGEMLGRHIVAVL
PEIDPVLFQGKIGLPILCVGSVWKSWELLKEGFLLALTQGREIQAQNFFS
SFTLMKLRHSSALGGASLGARHIGHLLPMDYSANAIAFYSYTFS*
a.a.
length
InterPro Name
length(272), motif(7:278) 272 IPR002731 ATPase, BadF/BadG/BcrA/BcrD type [Domain]