H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000248404 Accession number: AJ518976 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Serine/threonine-protein kinase MRCK alpha isoform B.
 
 

Transcript original information
Accession number AJ518976.1
CAGE tag ID NA
EST ID NA
Clone Number NA
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (CDC42BPA) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (CDC42BPA);
Sequence data provider NA
Annotation project NA
Length of cDNA 4917[bp] (No. of exon:35)[A:1654 T:1233 G:1108 C:922]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type colon
Develpmental stage adult
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) CAGAAG;  TAGGAG; 
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0001650
Genomic location  G-integra Help Chromosome 1
Location 1q42.13
Position 227181969- 227504883
Strand -
Possible duplicated location(s) NA
Gene structure 35 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:8476
KEGG GENES KEGG GENES(8476)
GeneCard GeneCardCDC42BPA*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000098024
Predicted CDS 1..4917;  1638[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.702

Motif information
ORF

length(1638),orf(1:4917)
MSGEVRLRQLEQFILDGPAQTNGQCFSVETLLDILICLYDECNNSPLRRE
KNILEYLEWAKPFTSKVKQMRLHREDFEILKVIGRGAFGEVAVVKLKNAD
KVFAMKILNKWEMLKRAETACFREERDVLVNGDNKWITTLHYAFQDDNNL
YLVMDYYVGGDLLTLLSKFEDRLPEDMARFYLAEMVIAIDSVHQLHYVHR
DIKPDNILMDMNGHIRLADFGSCLKLMEDGTVQSSVAVGTPDYISPEILQ
AMEDGKGRYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKER
FQFPAQVTDVSENAKDLIRRLICSREHRLGQNGIEDFKKHPFFSGIDWDN
IRNCEAPYIPEVSSPTDTSNFDVDDDCLKNSETMPPPTHTAFSGHHLPFV
GFTYTSSCVLSDRSCLRVTAGPTSLDLDVNVQRTLDNNLATEAYERRIKR
LEQEKLELSRKLQESTQTVQALQYSTVDGPLTASKDLEIKNLKEEIEKLR
KQVTESSHLEQQLEEANAVRQELDDAFRQIKAYEKQIKTLQQEREDLNKL
EVHTEALAAEASKDRKLREQSEHYSKQLENELEGLKQKQISYSPGVCSIE
HQQEITKLKTDLEKKSIFYEEELSKREGIHANEIKNLKKELHDSEGQQLA
LNKEIMILKDKLEKTRRESQSEREEFESEFKQQYEREKVLLTEENKKLTS
ELDKLTTLYENLSIHNQQLEEEVKDLADKKESVAHWEAQITEIIQWVSDE
KDARGYLQALASKMTEELEALRNSSLGTRATDMPWKMRRFAKLDMSARLE
LQSALDAEIRAKQAIQEELNKVKASNIITECKLKDSEKKNLELLSEIEQL
IKDTEELRSEKGIEHQDSQHSFLAFLNTPTDALDQFETVDSTPLSVHTPT
LRKKGCPGSTGFPPKRKTHQFFVKSFTTPTKCHQCTSLMVGLIRQGCSCE
VCGFSCHITCVNKAPTTCPVPPEQTKGPLGIDPQKGIGTAYEGHVRIPKP
...
a.a.
length
InterPro Name
length(1503), motif(1:1503) 1503 IPR026611 Serine/threonine-protein kinase MRCK alpha [Family]
length(345), motif(56:400) 345 IPR011009 Protein kinase-like domain [Domain]
length(267), motif(77:343) 267 IPR002290 Serine/threonine/dual specificity protein kinase, catalytic domain [Domain]
length(267), motif(77:343) 267 IPR000719 Protein kinase domain [Domain]
length(24), motif(83:106) 24 IPR017441 Protein kinase, ATP binding site [Binding_site]
length(13), motif(197:209) 13 IPR008271 Serine/threonine-protein kinase, active site [Active_site]
length(71), motif(344:414) 71 IPR000961 AGC-kinase, C-terminal [Domain]
length(63), motif(344:406) 63 IPR000961 AGC-kinase, C-terminal [Domain]
length(46), motif(361:406) 46 IPR017892 Protein kinase, C-terminal [Domain]
length(117), motif(786:902) 117 IPR014930 Myotonic dystrophy protein kinase, coiled coil [Domain]
length(61), motif(800:860) 61 IPR014930 Myotonic dystrophy protein kinase, coiled coil [Domain]
length(51), motif(918:968) 51 IPR002219 Protein kinase C-like, phorbol ester/diacylglycerol-binding domain [Domain]
length(51), motif(919:969) 51 IPR002219 Protein kinase C-like, phorbol ester/diacylglycerol-binding domain [Domain]
length(50), motif(919:968) 50 IPR002219 Protein kinase C-like, phorbol ester/diacylglycerol-binding domain [Domain]
length(120), motif(988:1107) 120 IPR001849 Pleckstrin homology domain [Domain]
length(121), motif(989:1109) 121 IPR001849 Pleckstrin homology domain [Domain]
length(273), motif(1133:1405) 273 IPR001180 Citron-like [Domain]
length(283), motif(1134:1416) 283 IPR001180 Citron-like [Domain]
length(263), motif(1139:1401) 263 IPR001180 Citron-like [Domain]
length(36), motif(1477:1512) 36 IPR000095 CRIB domain [Domain]
length(14), motif(1477:1490) 14 IPR000095 CRIB domain [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000248404
H-Inv cluster ID Locus viewHIX0001650
Accession number AJ518976.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Similar to Serine/threonine-protein kinase MRCK alpha isoform B.
Similarity category  Help Category: Similar to known protein(Category II).
Similar to known protein (NP_003598)  [Identity/coverage = 99.937%/97.15%] to Homo sapiens protein.
Experimental evidence Protein evidence
PubMed ID NA
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol CDC42BPA
HGNC aliases "CDC42-binding protein kinase alpha (DMPK-like)"
HGNC name CDC42 binding protein kinase alpha (DMPK-like)
DDBJ CDC42BPA
UniProt NA
EC number EC 2.7.11.1non-specific serine/threonine protein kinase; 
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway 04150 :mTOR signaling pathway;  04210 :Apoptosis;  04310 :Wnt signaling pathway;  04320 :Dorso-ventral axis formation;  04340 :Hedgehog signaling pathway;  04350 :TGF-beta signaling pathway;  04360 :Axon guidance;  04370 :VEGF signaling pathway;  04510 :Focal adhesion;  04520 :Adherens junction;  04530 :Tight junction;  04540 :Gap junction;  04620 :Toll-like receptor signaling pathway;  04630 :Jak-STAT signaling pathway;  04660 :T cell receptor signaling pathway;  04662 :B cell receptor signaling pathway;  04664 :Fc epsilon RI signaling pathway;  04720 :Long-term potentiation;  04730 :Long-term depression;  04810 :Regulation of actin cytoskeleton;  04910 :Insulin signaling pathway;  04912 :GnRH signaling pathway;  04920 :Adipocytokine signaling pathway;  05010 :Alzheimer's disease;  05210 :Colorectal cancer; 
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000098024
No. of interaction 5
Interaction partner(s) HIP000037174HIP000037399HIP000080656HIP000097487HIP000104907
BIND NA
DIP NA
MINT NA
HPRD 01181;  03585;  11452;  17619; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:8476
KEGG GENES KEGG GENES(8476)
GeneCard GeneCardCDC42BPA*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function transferase activity, transferring phosphorus-containing groups (GO:0016772);  ATP binding (GO:0005524);  protein kinase activity (GO:0004672);  protein serine/threonine kinase activity (GO:0004674); 
Biological process protein amino acid phosphorylation (GO:0006468);  actin cytoskeleton reorganization (GO:0031532); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT nuclear;  cytosol; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
6 343 1nw1A 4e-45 7.7 325/365 d.144.1.8
332 434 3d19A1 2e-19 9.7 103/134 a.29.13.1
916 976 1tbnA 6e-18 36.1 61/66 g.49.1.1
983 1111 1v5pA 8e-06 12.1 116/126 b.55.1.1
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsA111209;  AGhsB080803;  AGhsC020813;  AGhsC081404; 
Affymetrix
GeneChip
HG-Focus 214464_at; 
HG-U133 214464_at; 
HG-U133A 214464_at; 
HG-U133A_2 214464_at; 
HG-U133B NA
HG-U133_Plus_2 214464_at; 
HG-U95 39962_at; 
HG-U95A 39962_at; 
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 2459050;  2459051;  2459055;  2459061;  2459062;  2459063;  2459064;  2459065;  2459066;  2459067;  2459068;  2459069;  2459070;  2459071;  2459072;  2459074;  2459076;  2459077;  2459080;  2459082;  2459095;  2459097;  2459098;  2459099;  2459100;  2459105;  2459107;  2459110;  2459112;  2459116;  2459118;  2459119;  2459120;  2459121;  2459122;  2459123;  2459125;  2459126;  2459133;  2459134;  2459135;  2459137;  2459151;  2459163;  2459164; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 A_23_P256190;  A_23_P44908; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P256190;  A_23_P51394; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
45 .. 45 G/A rs200600700 - CDS Synonymous[Leu15Leu]
54 .. 54 C/T rs185771662 - CDS Synonymous[Pro18Pro]
69 .. 69 G/A rs139047710 - CDS Synonymous[Gly23Gly]
72 .. 72 G/T rs146651448 - CDS Nonsynonymous[Gln24His]
90 .. 90 A/G rs11804613 - CDS Synonymous[Thr30Thr]
128 .. 128 A/G rs201862186 - CDS Nonsynonymous[Asn43Ser]
139 .. 139 T/C rs144296174 - CDS Synonymous[Leu47Leu]
258 .. 258 A/G rs11548283 + CDS Synonymous[Gly86Gly]
308 ^ 309 -/T rs66970709 - CDS
390 .. 390 G/T rs138147922 - CDS Synonymous[Val130Val]
400 .. 400 A/G rs147024844 - CDS Nonsynonymous[Asn134Asp]
415 .. 415 A/G rs146827361 - CDS Nonsynonymous[Thr139Ala]
430 ^ 431 -/T rs66481220 - CDS
479 .. 479 G/A rs201422232 - CDS Nonsynonymous[Gly160Glu]
536 .. 536 G/A rs201287522 - CDS Nonsynonymous[Arg179Lys]
540 ^ 541 -/T rs67564598 - CDS
546 .. 546 G/A rs151080605 - CDS Synonymous[Leu182Leu]
585 .. 585 A/G rs201936989 - CDS Synonymous[Leu195Leu]
632 .. 632 T/G rs148839966 - CDS Nonsynonymous[Met211Arg]
645 ^ 646 -/T rs35643738 - CDS
692 .. 692 C/T rs34614709 - CDS Nonsynonymous[Thr231Met]
831 .. 831 C/T rs139987030 - CDS Synonymous[Tyr277Tyr]
870 .. 870 A/G rs56311356 - CDS Synonymous[Thr290Thr]
873 .. 873 C/T rs141895289 - CDS Synonymous[Tyr291Tyr]
1006 .. 1006 G/A rs200168774 - CDS Nonsynonymous[Asp336Asn]
1016 ^ 1017 -/A rs67972781 - CDS
1100 .. 1100 A/G rs111893322 - CDS Nonsynonymous[Asp367Gly]
1138 .. 1138 A/T rs147469048 - CDS Nonsynonymous[Asn380Tyr]
1165 .. 1165 C/T rs201384556 - CDS Nonsynonymous[His389Tyr]
1243 .. 1243 T/C rs201022380 - CDS Nonsynonymous[Cys415Arg]
1263 .. 1263 T/G rs201645647 - CDS Synonymous[Gly421Gly]
1269 .. 1269 C/T rs201820010 - CDS Synonymous[Thr423Thr]
1507 .. 1507 G/A rs139384904 - CDS Nonsynonymous[Val503Ile]
1573 .. 1573 G/A rs200713147 - CDS Nonsynonymous[Asp525Asn]
1581 .. 1581 T/- rs66665503 - CDS
1587 .. 1587 A/G rs149633059 - CDS Synonymous[Gln529Gln]
1594 .. 1594 G/A rs201130103 - CDS Nonsynonymous[Ala532Thr]
1610 .. 1610 T/C rs56364976 - CDS Nonsynonymous[Ile537Thr]
1741 .. 1741 G/A rs199746122 - CDS Nonsynonymous[Glu581Lys]
1782 .. 1782 A/G rs200326381 - CDS Synonymous[Pro594Pro]
1795 .. 1795 A/G rs140818561 - CDS Nonsynonymous[Ile599Val]
1823 .. 1823 T/C rs201126700 - CDS Nonsynonymous[Leu608Pro]
1845 ^ 1846 -/A rs67804260 - CDS
1849 .. 1849 A/G rs142697103 - CDS Nonsynonymous[Ile617Val]
1856 .. 1856 A/T rs201979872 - CDS Nonsynonymous[Tyr619Phe]
1973 .. 1973 T/- rs67734085 - CDS
1978 .. 1978 G/A rs3939280 - CDS Nonsynonymous[Asp660Asn]
1988 .. 1988 A/G rs200068494 - CDS Nonsynonymous[Glu663Gly]
2005 .. 2005 A/G rs145584750 - CDS Nonsynonymous[Ser669Gly]
2096 .. 2096 C/T rs56119119 - CDS Nonsynonymous[Thr699Met]
2120 ^ 2121 -/G rs66555523 - CDS
2126 .. 2126 A/G rs34943764 - CDS Nonsynonymous[Tyr709Cys]
2230 .. 2230 A/C rs77122651 - CDS Nonsynonymous[Ile744Leu]
2265 .. 2265 G/T rs142030346 - CDS Synonymous[Gly755Gly]
2373 .. 2373 G/A rs200154961 - CDS Synonymous[Ala791Ala]
2408 .. 2408 C/T rs144801895 - CDS Nonsynonymous[Ser803Leu]
2409 .. 2409 G/A rs35017425 - CDS Synonymous[Ser803Ser]
2445 .. 2445 C/T rs137890180 - CDS Synonymous[Ile815Ile]
2455 .. 2455 T/C rs200668164 - CDS Synonymous[Leu819Leu]
2491 .. 2491 T/A rs199653014 - CDS Nonsynonymous[Cys831Ser]
2513 .. 2513 A/C rs200440295 - CDS Nonsynonymous[Lys838Thr]
2529 .. 2529 A/G rs199733498 - CDS Synonymous[Leu843Leu]
2541 .. 2541 C/T rs55845581 - CDS Synonymous[Ile847Ile]
2669 .. 2669 A/G rs150700769 - CDS Nonsynonymous[Asp890Gly]
2723 .. 2723 G/C rs199543596 - CDS Nonsynonymous[Gly908Ala]
2747 .. 2747 G/A rs140416725 - CDS Nonsynonymous[Arg916His]
2754 .. 2754 T/C rs113402500 - CDS Synonymous[Thr918Thr]
2780 .. 2780 C/T rs202057695 - CDS Nonsynonymous[Thr927Ile]
2836 .. 2836 G/A rs112933697 - CDS Nonsynonymous[Gly946Ser]
2887 .. 2887 A/G rs142183701 - CDS Nonsynonymous[Lys963Glu]
2918 ^ 2919 -/A rs35357574 - CDS
2952 .. 2952 G/A rs35369012 - CDS Synonymous[Gln984Gln]
2960 .. 2960 T/C rs200344808 - CDS Nonsynonymous[Ile987Thr]
3156 .. 3156 C/T rs201643732 - CDS Synonymous[Val1052Val]
3160 .. 3160 G/A rs56219089 - CDS Nonsynonymous[Ala1054Thr]
3198 .. 3198 C/T rs149978094 - CDS Synonymous[Pro1066Pro]
3222 .. 3222 C/T rs200331694 - CDS Synonymous[Ser1074Ser]
3326 .. 3326 T/- rs67003899 - CDS
3343 .. 3343 A/G rs181637825 - CDS Nonsynonymous[Arg1115Gly]
3350 .. 3350 G/A rs961490 - CDS Nonsynonymous[Arg1117His]
3512 .. 3512 A/G rs201692012 - CDS Nonsynonymous[Asn1171Ser]
3544 .. 3544 A/T rs200594653 - CDS Nonsynonymous[Asn1182Tyr]
3615 .. 3615 T/C rs180784576 - CDS Synonymous[Asp1205Asp]
3627 .. 3627 C/T rs189930745 - CDS Synonymous[Thr1209Thr]
3667 .. 3667 G/A/C/T rs1929860 + CDS
3686 .. 3686 G/A rs200056759 - CDS Nonsynonymous[Arg1229His]
3727 .. 3727 C/G rs201775243 - CDS Nonsynonymous[Gln1243Glu]
3764 .. 3764 G/A rs200051797 - CDS Nonsynonymous[Arg1255His]
3780 .. 3780 A/G rs1929861 + CDS Synonymous[Lys1260Lys]
3789 .. 3789 A/G rs200690739 - CDS Synonymous[Gln1263Gln]
3793 .. 3793 C/A rs149240330 - CDS Nonsynonymous[Pro1265Thr]
3817 .. 3817 A/G rs146203858 - CDS Nonsynonymous[Ile1273Val]
3887 .. 3887 A/- rs66656566 - CDS
3895 .. 3895 A/G rs200486377 - CDS Nonsynonymous[Ser1299Gly]
3961 .. 3961 G/A rs183857756 - CDS Nonsynonymous[Ala1321Thr]
3963 .. 3963 A/G rs199656326 - CDS Synonymous[Ala1321Ala]
4066 .. 4066 G/T rs147617327 - CDS Nonsynonymous[Ala1356Ser]
4079 .. 4079 C/G rs142464333 - CDS Nonsynonymous[Ser1360Cys]
4107 .. 4107 G/A rs142853761 - CDS Synonymous[Ser1369Ser]
4124 .. 4124 C/T rs55687355 - CDS Nonsynonymous[Ala1375Val]
4147 .. 4147 T/C rs112426338 - CDS Nonsynonymous[Ser1383Pro]
4199 .. 4199 A/G rs146136586 - CDS Nonsynonymous[Asn1400Ser]
4253 .. 4253 A/T rs56229267 - CDS Nonsynonymous[Lys1418Ile]
4256 .. 4256 A/G rs139110633 - CDS Nonsynonymous[Asn1419Ser]
4346 .. 4346 G/A rs201852267 - CDS Nonsynonymous[Arg1449His]
4399 .. 4399 C/T rs12561938 - CDS Synonymous[Leu1467Leu]
4465 .. 4465 A/G rs200918078 - CDS Nonsynonymous[Met1489Val]
4494 .. 4494 G/C rs55848092 - CDS Synonymous[Leu1498Leu]
4497 .. 4497 A/G rs141188296 - CDS Synonymous[Lys1499Lys]
4563 .. 4563 A/G rs145724581 - CDS Synonymous[Pro1521Pro]
4567 .. 4567 A/G rs199675358 - CDS Nonsynonymous[Ile1523Val]
4570 .. 4570 A/G rs2297417 + CDS Nonsynonymous[Thr1524Ala]
4579 .. 4579 C/T rs148881297 - CDS Nonsynonymous[Arg1527Cys]
4608 .. 4608 T/C rs150430697 - CDS Synonymous[Ala1536Ala]
4635 .. 4635 C/T rs16846779 - CDS Synonymous[Ser1545Ser]
4650 .. 4650 C/T rs147810081 - CDS Synonymous[Ser1550Ser]
4702 .. 4702 A/G rs145538584 - CDS Nonsynonymous[Met1568Val]
4727 .. 4727 T/C rs200692909 - CDS Nonsynonymous[Leu1576Ser]
4734 .. 4734 C/T rs1045247 + CDS Synonymous[Ser1578Ser]
4767 .. 4767 G/A rs201963139 - CDS Synonymous[Ala1589Ala]
4780 .. 4780 G/A rs143404397 - CDS Nonsynonymous[Gly1594Arg]
4797 .. 4797 T/C rs147437313 - CDS Synonymous[Ser1599Ser]
4799 .. 4799 C/T rs148249654 - CDS Nonsynonymous[Pro1600Leu]
4843 ^ 4844 -/C rs67581567 - CDS
4853 .. 4853 T/C rs2802269 - CDS Nonsynonymous[Val1618Ala]
4862 .. 4862 G/A rs145018031 - CDS Nonsynonymous[Arg1621Gln]
4874 .. 4874 G/T rs146538430 - CDS Nonsynonymous[Ser1625Ile]
4882 .. 4882 C/T rs140582350 - CDS Synonymous[Leu1628Leu]
4904 .. 4904 G/A rs142402392 - CDS Nonsynonymous[Ser1635Asn]
4914 .. 4914 G/A rs56027641 - CDS Synonymous[Pro1638Pro]
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer