H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000248404 Accession number: AJ518976 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Serine/threonine-protein kinase MRCK alpha isoform B.
 
 

Motif information
ORF

length(1638),orf(1:4917)
MSGEVRLRQLEQFILDGPAQTNGQCFSVETLLDILICLYDECNNSPLRRE
KNILEYLEWAKPFTSKVKQMRLHREDFEILKVIGRGAFGEVAVVKLKNAD
KVFAMKILNKWEMLKRAETACFREERDVLVNGDNKWITTLHYAFQDDNNL
YLVMDYYVGGDLLTLLSKFEDRLPEDMARFYLAEMVIAIDSVHQLHYVHR
DIKPDNILMDMNGHIRLADFGSCLKLMEDGTVQSSVAVGTPDYISPEILQ
AMEDGKGRYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKER
FQFPAQVTDVSENAKDLIRRLICSREHRLGQNGIEDFKKHPFFSGIDWDN
IRNCEAPYIPEVSSPTDTSNFDVDDDCLKNSETMPPPTHTAFSGHHLPFV
GFTYTSSCVLSDRSCLRVTAGPTSLDLDVNVQRTLDNNLATEAYERRIKR
LEQEKLELSRKLQESTQTVQALQYSTVDGPLTASKDLEIKNLKEEIEKLR
KQVTESSHLEQQLEEANAVRQELDDAFRQIKAYEKQIKTLQQEREDLNKL
EVHTEALAAEASKDRKLREQSEHYSKQLENELEGLKQKQISYSPGVCSIE
HQQEITKLKTDLEKKSIFYEEELSKREGIHANEIKNLKKELHDSEGQQLA
LNKEIMILKDKLEKTRRESQSEREEFESEFKQQYEREKVLLTEENKKLTS
ELDKLTTLYENLSIHNQQLEEEVKDLADKKESVAHWEAQITEIIQWVSDE
KDARGYLQALASKMTEELEALRNSSLGTRATDMPWKMRRFAKLDMSARLE
LQSALDAEIRAKQAIQEELNKVKASNIITECKLKDSEKKNLELLSEIEQL
IKDTEELRSEKGIEHQDSQHSFLAFLNTPTDALDQFETVDSTPLSVHTPT
LRKKGCPGSTGFPPKRKTHQFFVKSFTTPTKCHQCTSLMVGLIRQGCSCE
VCGFSCHITCVNKAPTTCPVPPEQTKGPLGIDPQKGIGTAYEGHVRIPKP
...
a.a.
length
InterPro Name
length(1503), motif(1:1503) 1503 IPR026611 Serine/threonine-protein kinase MRCK alpha [Family]
length(345), motif(56:400) 345 IPR011009 Protein kinase-like domain [Domain]
length(267), motif(77:343) 267 IPR002290 Serine/threonine/dual specificity protein kinase, catalytic domain [Domain]
length(267), motif(77:343) 267 IPR000719 Protein kinase domain [Domain]
length(24), motif(83:106) 24 IPR017441 Protein kinase, ATP binding site [Binding_site]
length(13), motif(197:209) 13 IPR008271 Serine/threonine-protein kinase, active site [Active_site]
length(71), motif(344:414) 71 IPR000961 AGC-kinase, C-terminal [Domain]
length(63), motif(344:406) 63 IPR000961 AGC-kinase, C-terminal [Domain]
length(46), motif(361:406) 46 IPR017892 Protein kinase, C-terminal [Domain]
length(117), motif(786:902) 117 IPR014930 Myotonic dystrophy protein kinase, coiled coil [Domain]
length(61), motif(800:860) 61 IPR014930 Myotonic dystrophy protein kinase, coiled coil [Domain]
length(51), motif(918:968) 51 IPR002219 Protein kinase C-like, phorbol ester/diacylglycerol-binding domain [Domain]
length(51), motif(919:969) 51 IPR002219 Protein kinase C-like, phorbol ester/diacylglycerol-binding domain [Domain]
length(50), motif(919:968) 50 IPR002219 Protein kinase C-like, phorbol ester/diacylglycerol-binding domain [Domain]
length(120), motif(988:1107) 120 IPR001849 Pleckstrin homology domain [Domain]
length(121), motif(989:1109) 121 IPR001849 Pleckstrin homology domain [Domain]
length(273), motif(1133:1405) 273 IPR001180 Citron-like [Domain]
length(283), motif(1134:1416) 283 IPR001180 Citron-like [Domain]
length(263), motif(1139:1401) 263 IPR001180 Citron-like [Domain]
length(36), motif(1477:1512) 36 IPR000095 CRIB domain [Domain]
length(14), motif(1477:1490) 14 IPR000095 CRIB domain [Domain]