H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000259606 Accession number: BC056881 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Beta-adducin isoform e.
 
 

Transcript original information
Accession number BC056881.1
CAGE tag ID NA
EST ID NA
Clone Number IMAGE:6139987
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (ADD2) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (ADD2);
Sequence data provider NA
Annotation project NA
Length of cDNA 2417[bp] (No. of exon:16)[A:628 T:399 G:712 C:678]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Eye, retinoblastoma
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature C-truncated
Kozak sequence NA
PolyA Site: 2403(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) CAGGAG;  TAGAAG; 
Transcript quality feature Truncation; 
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0029808
Genomic location  G-integra Help Chromosome 2
Location 2p13.3
Position 70890629- 70995158
Strand -
Possible duplicated location(s) NA
Gene structure 16 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:119
KEGG GENES KEGG GENES(119)
GeneCard GeneCardADD2*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000097062
Predicted CDS 295..2417;  707[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.811

Motif information
ORF

length(707),orf(295:2417)
MSEETVPEAASPPPPQGQPYFDRFSEDDPEYMRLRNRAADLRQDFNLMEQ
KKRVTMILQSPSFREELEGLIQEQMKKGNNSSNIWALRQIADFMASTSHA
VFPTSSMNVSMMTPINDLHTADSLNLAKGERLMRCKISSVYRLLDLYGWA
QLSDTYVTLRVSKEQDHFLISPKGVSCSEVTASSLIKVNILGEVVEKGSS
CFPVDTTGFCLHSAIYAARPDVRCIIHLHTPATAAVSAMKWGLLPVSHNA
LLVGDMAYYDFNGEMEQEADRINLQKCLGPTCKILVLRNHGVVALGDTVE
EAFYKIFHLQAACEIQVSALSSAGGVENLILLEQEKHRPHEVGSVQWAGS
TFGPMQKSRLGEHEFEALMRMLDNLGYRTGYTYRHPFVQEKTKHKSEVEI
PATVTAFVFEEDGAPVPALRQHAQKQQKEKTRWLNTPNTYLRVNVADEVQ
RSMGSPRPKTTWMKADEVEKSSSGMPIRIENPNQFVPLYTDPQEVLEMRN
KIREQNRQDVKSAGPQSQLLASVIAEKSRSPSTESQLMSKGDEDTKDDSE
ETVPNPFSQLTDQELEEYKKEVERKKLELDGEKETAPEEPGSPAKSAPAS
PVQSPAKEAETKSPLVSPSKSLEEGTKKTETSKAATTEPETTQPEGVVVN
GREEEQTAEEILSKGLSQMTTSADTDVDTSKDKTESVTSGPMSPEGSPSK
SPSKKKK
a.a.
length
InterPro Name
length(707), motif(1:707) 707 IPR027773 Beta-adducin [Family]
length(206), motif(130:335) 206 IPR001303 Class II aldolase/adducin N-terminal [Domain]
length(193), motif(130:322) 193 IPR001303 Class II aldolase/adducin N-terminal [Domain]
length(183), motif(135:317) 183 IPR001303 Class II aldolase/adducin N-terminal [Domain]
length(182), motif(136:317) 182 IPR001303 Class II aldolase/adducin N-terminal [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000259606
H-Inv cluster ID Locus viewHIX0029808
Accession number BC056881.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Similar to Beta-adducin isoform e.
Similarity category  Help Category: Similar to known protein(Category II).
Similar to known protein (NP_059522)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens protein.
Experimental evidence Protein evidence
PubMed ID NA
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol ADD2
HGNC aliases NA
HGNC name adducin 2 (beta)
DDBJ ADD2
UniProt NA
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000097062
No. of interaction 11
Interaction partner(s) HIP000025285HIP000026208HIP000029340HIP000030685HIP000033437HIP000033560HIP000042542HIP000043538HIP000043538HIP000060745HIP000082857
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:119
KEGG GENES KEGG GENES(119)
GeneCard GeneCardADD2*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
FR ID FR181793
Accession
Description
Location
PMID
FR ID FR234658
Accession
Description
Location
PMID

Gene ontology information
Cellular component cytoskeleton (GO:0005856); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT nuclear;  cytosol; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsB140706;  AGhsB140806;  AGhsB140906; 
Affymetrix
GeneChip
HG-Focus NA
HG-U133 NA
HG-U133A NA
HG-U133A_2 NA
HG-U133B NA
HG-U133_Plus_2 NA
HG-U95 36051_s_at; 
HG-U95A 36051_s_at; 
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 2558756;  2558765;  2558767;  2558768;  2558772;  2558774;  2558776;  2558780;  2558781;  2558783;  2558790;  2558791;  2558792;  2558798;  2558799;  2558800;  2558801;  2558805;  2558818; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 NA
Whole Human Genome Oligo Microarray:PGID247 NA
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
30 .. 30 C/T rs2287097 - 5'UTR
43 .. 43 T/C rs115262291 - 5'UTR
63 .. 63 A/G rs146289331 - 5'UTR
285 .. 285 C/T rs188664399 - 5'UTR
289 .. 289 G/A rs199889944 - 5'UTR
293 .. 293 A/G rs62642474 - 5'UTR
301 .. 301 G/A rs200519011 - CDS Nonsynonymous[Glu3Lys]
341 .. 341 A/G rs201443444 - CDS Nonsynonymous[Gln16Arg]
344 .. 344 G/A rs34241538 + CDS Nonsynonymous[Gly17Glu]
376 .. 376 G/A rs4986 + CDS Nonsynonymous[Asp28Asn]
411 .. 411 G/A rs141187526 - CDS Synonymous[Ala39Ala]
419 .. 419 G/A rs144732476 - CDS Nonsynonymous[Arg42Gln]
426 .. 426 C/G rs138167651 - CDS Nonsynonymous[Asp44Glu]
493 .. 493 C/T rs114456016 - CDS Synonymous[Leu67Leu]
500 .. 500 G/T rs149147182 - CDS Nonsynonymous[Gly69Val]
546 .. 546 C/A rs17006140 - CDS Synonymous[Ile84Ile]
555 .. 555 G/A rs144778680 - CDS Synonymous[Leu87Leu]
564 .. 564 C/T rs200212314 - CDS Synonymous[Ile90Ile]
565 .. 565 G/A rs150703767 - CDS Nonsynonymous[Ala91Thr]
587 .. 587 C/G rs4987 + CDS Nonsynonymous[Ser98Cys]
603 .. 603 G/A rs144423262 - CDS Synonymous[Pro103Pro]
682 .. 682 G/A rs75081591 - CDS Nonsynonymous[Glu130Lys]
691 .. 691 A/C rs145968821 - CDS Nonsynonymous[Met133Leu]
732 .. 732 C/G rs114904807 - CDS Synonymous[Leu146Leu]
794 .. 794 A/G rs138007719 - CDS Nonsynonymous[His167Arg]
840 .. 840 G/A rs150383515 - CDS Synonymous[Ala182Ala]
847 .. 847 C/T rs200581515 - CDS Synonymous[Leu185Leu]
857 .. 857 T/A rs7425188 - CDS Nonsynonymous[Val188Glu]
901 .. 901 C/T rs148091443 - CDS Nonsynonymous[Pro203Ser]
918 .. 918 C/T rs147916626 - CDS Synonymous[Gly208Gly]
933 .. 933 G/A rs144869244 - CDS Synonymous[Ser213Ser]
945 .. 945 A/G rs181512905 - CDS Synonymous[Ala217Ala]
958 .. 958 G/A rs144714020 - CDS Nonsynonymous[Val222Met]
967 .. 967 A/G rs200730724 - CDS Nonsynonymous[Ile225Val]
980 .. 980 A/G rs201811808 - CDS Nonsynonymous[His229Arg]
1126 .. 1126 C/G rs145329028 - CDS Nonsynonymous[Leu278Val]
1152 .. 1152 G/A rs139387703 - CDS Synonymous[Val286Val]
1153 .. 1153 C/T rs111700825 - CDS Synonymous[Leu287Leu]
1168 .. 1168 G/T rs139808041 - CDS Nonsynonymous[Val292Leu]
1203 .. 1203 T/C rs4989 + CDS Synonymous[Phe303Phe]
1248 .. 1248 G/A rs142433540 - CDS Synonymous[Ser318Ser]
1264 .. 1264 G/A rs201864311 - CDS Nonsynonymous[Gly324Arg]
1290 .. 1290 G/A rs144529989 - CDS Synonymous[Leu332Leu]
1298 .. 1298 A/T rs61030669 - CDS Nonsynonymous[Glu335Val]
1299 .. 1299 G/T rs4982 + CDS Nonsynonymous[Glu335Asp]
1305 .. 1305 C/A rs142392995 - CDS Nonsynonymous[His337Gln]
1307 .. 1307 G/A rs146561886 - CDS Nonsynonymous[Arg338Gln]
1439 .. 1439 C/T rs145886276 - CDS Nonsynonymous[Thr382Met]
1440 .. 1440 G/A rs139827624 - CDS Synonymous[Thr382Thr]
1502 .. 1502 C/T rs199834771 - CDS Nonsynonymous[Thr403Met]
1516 .. 1516 G/A rs34196785 + CDS Nonsynonymous[Val408Met]
1526 .. 1526 A/G rs150772862 - CDS Nonsynonymous[Glu411Gly]
1539 .. 1539 G/A rs148662450 - CDS Synonymous[Pro415Pro]
1601 .. 1601 C/T rs201022450 - CDS Nonsynonymous[Thr436Met]
1602 .. 1602 G/T rs143711744 - CDS Synonymous[Thr436Thr]
1609 .. 1609 A/G rs17855969 - CDS Nonsynonymous[Thr439Ala]
1670 .. 1670 A/G rs201449367 - CDS Nonsynonymous[Lys459Arg]
1692 .. 1692 C/T rs188058882 - CDS Synonymous[Asp466Asp]
1722 .. 1722 G/A rs34884423 + CDS Synonymous[Pro476Pro]
1727 .. 1727 G/A rs150426440 - CDS Nonsynonymous[Arg478His]
1731 .. 1731 C/T rs199802003 - CDS Synonymous[Ile479Ile]
1796 .. 1796 A/G rs112879637 - CDS Nonsynonymous[Lys501Arg]
1803 .. 1803 A/C rs145174076 - CDS Synonymous[Arg503Arg]
1833 .. 1833 G/C rs115841739 - CDS Synonymous[Ala513Ala]
1860 .. 1860 C/T rs148402316 - CDS Synonymous[Ser522Ser]
1869 .. 1869 C/G rs201133279 - CDS Synonymous[Ala525Ala]
1877 .. 1877 G/C rs149689098 - CDS Nonsynonymous[Ser528Thr]
1880 .. 1880 G/T rs114311724 - CDS Nonsynonymous[Arg529Leu]
1921 .. 1921 G/A rs139586218 - CDS Nonsynonymous[Glu543Lys]
1949 .. 1949 C/T rs114897963 - CDS Nonsynonymous[Thr552Met]
1971 .. 1971 A/G rs115445925 - CDS Synonymous[Gln559Gln]
2111 .. 2111 C/T rs141431061 - CDS Nonsynonymous[Ala606Val]
2119 .. 2119 G/A rs138503054 - CDS Nonsynonymous[Ala609Thr]
2126 .. 2126 C/A rs140129786 - CDS Nonsynonymous[Thr611Lys]
2172 .. 2172 T/G rs199908987 - CDS Synonymous[Thr626Thr]
2197 .. 2197 G/A rs149050833 - CDS Nonsynonymous[Ala635Thr]
2200 .. 2200 A/G rs145267894 - CDS Nonsynonymous[Thr636Ala]
2226 .. 2226 G/A rs115476558 - CDS Synonymous[Pro644Pro]
2283 .. 2283 C/A rs4985 + CDS Nonsynonymous[Ser663Arg]
2294 .. 2294 G/A rs147439886 - CDS Nonsynonymous[Ser667Asn]
2319 .. 2319 G/A rs139265334 - CDS Synonymous[Thr675Thr]
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer