H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000259606 Accession number: BC056881 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Beta-adducin isoform e.
 
 

Motif information
ORF

length(707),orf(295:2417)
MSEETVPEAASPPPPQGQPYFDRFSEDDPEYMRLRNRAADLRQDFNLMEQ
KKRVTMILQSPSFREELEGLIQEQMKKGNNSSNIWALRQIADFMASTSHA
VFPTSSMNVSMMTPINDLHTADSLNLAKGERLMRCKISSVYRLLDLYGWA
QLSDTYVTLRVSKEQDHFLISPKGVSCSEVTASSLIKVNILGEVVEKGSS
CFPVDTTGFCLHSAIYAARPDVRCIIHLHTPATAAVSAMKWGLLPVSHNA
LLVGDMAYYDFNGEMEQEADRINLQKCLGPTCKILVLRNHGVVALGDTVE
EAFYKIFHLQAACEIQVSALSSAGGVENLILLEQEKHRPHEVGSVQWAGS
TFGPMQKSRLGEHEFEALMRMLDNLGYRTGYTYRHPFVQEKTKHKSEVEI
PATVTAFVFEEDGAPVPALRQHAQKQQKEKTRWLNTPNTYLRVNVADEVQ
RSMGSPRPKTTWMKADEVEKSSSGMPIRIENPNQFVPLYTDPQEVLEMRN
KIREQNRQDVKSAGPQSQLLASVIAEKSRSPSTESQLMSKGDEDTKDDSE
ETVPNPFSQLTDQELEEYKKEVERKKLELDGEKETAPEEPGSPAKSAPAS
PVQSPAKEAETKSPLVSPSKSLEEGTKKTETSKAATTEPETTQPEGVVVN
GREEEQTAEEILSKGLSQMTTSADTDVDTSKDKTESVTSGPMSPEGSPSK
SPSKKKK
a.a.
length
InterPro Name
length(707), motif(1:707) 707 IPR027773 Beta-adducin [Family]
length(206), motif(130:335) 206 IPR001303 Class II aldolase/adducin N-terminal [Domain]
length(193), motif(130:322) 193 IPR001303 Class II aldolase/adducin N-terminal [Domain]
length(183), motif(135:317) 183 IPR001303 Class II aldolase/adducin N-terminal [Domain]
length(182), motif(136:317) 182 IPR001303 Class II aldolase/adducin N-terminal [Domain]