H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000261130 Accession number: BC063676 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to ETS domain-containing protein Elk-4 isoform b.
 
 

Transcript original information
Accession number BC063676.1
CAGE tag ID NA
EST ID NA
Clone Number MGC:75159 IMAGE:4364006
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (SLC45A3) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (SLC45A3);
Sequence data provider NA
Annotation project NA
Length of cDNA 1820[bp] (No. of exon:2)[A:564 T:513 G:322 C:421]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Lymph, lymphoma
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 1805(+) Signal: 1786-1790(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0028754
Genomic location  G-integra Help Chromosome 1
Location 1q32.1
Position 205588400- 205593020
Strand -
Possible duplicated location(s) NA
Gene structure 2 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:2005
KEGG GENES KEGG GENES(2005)
GeneCard GeneCardSLC45A3*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000042682
Predicted CDS 31..1248;  405[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.739
Database links RefSeq NP_068567
UniProt NA
CCDS CCDS1457

Motif information
ORF

length(405),orf(31:1248)
MDSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKN
KPNMNYDKLSRALRYYYVKNIIKKVNGQKFVYKFVSYPEILNMDPMTVGR
IEGDCESLNFSEVSSSSKDVENGGKDKPPQPGAKTSSRNDYIHSGLYSSF
TLNSLNSSNVKLFKLIKTENPAEKLAEKKSPQEPTPSVIKFVTTPSKKPP
VEPVAATISIGPSISPSSEETIQALETLVSPKLPSLEAPTSASNVMTAFA
TTPPISSIPPLQEPPRTPSPPLSSHPDIDTDIDSVASQPMELPENLSLEP
KDQDSVLLEKDKVNNSSRSKKPKGLELAPTLVITSSDPSPLGILSPSLPT
ASLTPAFFSQVACSLFMVSPLLSFICPFKQIQNLYTQVCFLLLRFVLERL
CVTVM*
a.a.
length
InterPro Name
length(93), motif(2:94) 93 IPR011991 Winged helix-turn-helix DNA-binding domain [Domain]
length(86), motif(4:89) 86 IPR000418 Ets domain [Domain]
length(82), motif(5:86) 82 IPR000418 Ets domain [Domain]
length(81), motif(5:85) 81 IPR000418 Ets domain [Domain]
length(14), motif(5:18) 14 IPR000418 Ets domain [Domain]
length(9), motif(7:15) 9 IPR000418 Ets domain [Domain]
length(19), motif(29:47) 19 IPR000418 Ets domain [Domain]
length(19), motif(48:66) 19 IPR000418 Ets domain [Domain]
length(16), motif(51:66) 16 IPR000418 Ets domain [Domain]
length(19), motif(67:85) 19 IPR000418 Ets domain [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000261130
H-Inv cluster ID Locus viewHIX0028754
Accession number BC063676.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Similar to ETS domain-containing protein Elk-4 isoform b.
Similarity category  Help Category: Similar to known protein(Category II).
Similar to known protein (NP_068567)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens protein.
Experimental evidence Protein evidence
PubMed ID NA
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol SLC45A3
HGNC aliases "prostate cancer associated protein 6", "prostate cancer associated protein 2", "prostate cancer associated protein 8"
HGNC name solute carrier family 45, member 3
DDBJ ELK4
UniProt NA
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000042682
No. of interaction NA
Interaction partner(s) NA
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:2005
KEGG GENES KEGG GENES(2005)
GeneCard GeneCardSLC45A3*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function sequence-specific DNA binding (GO:0043565);  transcription factor activity (GO:0003700); 
Biological process regulation of transcription, DNA-dependent (GO:0006355); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT nuclear;  plasma membrane;  peroxisome; 
Target P signal peptide
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
1 93 1bc7C 3e-30 100.0 93/93 a.4.5.21
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsA011618; 
Affymetrix
GeneChip
HG-Focus 206919_at; 
HG-U133 206919_at; 
HG-U133A 206919_at; 
HG-U133A_2 206919_at; 
HG-U133B NA
HG-U133_Plus_2 206919_at; 
HG-U95 38496_at; 
HG-U95A 38496_at; 
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 2452590;  2452591;  2452592;  2452593;  2452594;  2452595; 
HuGeneFL M85164_at; 
Agilent Human 1A Oligo Microarray:PGID215 A_23_P161098; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P161098; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
37 .. 37 A/G rs146371497 - CDS Nonsynonymous[Ser3Gly]
43 .. 43 A/G rs138936782 - CDS Nonsynonymous[Ile5Val]
57 .. 57 G/T rs141838398 - CDS Nonsynonymous[Gln9His]
69 .. 69 G/C rs147053192 - CDS Nonsynonymous[Gln13His]
77 .. 77 A/G rs139169305 - CDS Nonsynonymous[Gln16Arg]
116 .. 116 A/G rs149095787 - CDS Nonsynonymous[Asn29Ser]
131 .. 131 A/G rs150376325 - CDS Nonsynonymous[Lys34Arg]
216 .. 216 C/G rs190546616 - CDS Synonymous[Ala62Ala]
255 .. 255 G/C rs146671060 - CDS Synonymous[Val75Val]
342 .. 342 C/T rs139855067 - CDS Synonymous[Asp104Asp]
360 .. 360 C/T rs142399517 - CDS Synonymous[Phe110Phe]
368 .. 368 T/C rs113173768 - CDS Nonsynonymous[Val113Ala]
376 .. 376 A/C rs144365511 - CDS Nonsynonymous[Ser116Arg]
397 .. 397 G/A rs145878431 - CDS Nonsynonymous[Gly123Arg]
409 .. 409 A/G rs139238464 - CDS Nonsynonymous[Lys127Glu]
416 .. 416 C/T rs186491224 - CDS Nonsynonymous[Pro129Leu]
442 .. 442 C/T rs143034780 - CDS Nonsynonymous[Arg138Cys]
528 .. 528 A/C rs183574998 - CDS Synonymous[Ile166Ile]
537 .. 537 G/T rs199770695 - CDS Nonsynonymous[Glu169Asp]
546 .. 546 C/T rs149424146 - CDS Synonymous[Ala172Ala]
553 .. 553 C/A rs201659900 - CDS Nonsynonymous[Leu175Met]
629 .. 629 C/T rs148037437 - CDS Nonsynonymous[Pro200Leu]
630 .. 630 G/A rs1064406 + CDS Synonymous[Pro200Pro]
690 .. 690 A/G rs144596474 - CDS Synonymous[Glu220Glu]
749 .. 749 C/T rs146453123 - CDS Nonsynonymous[Thr240Ile]
775 .. 775 T/C rs139845492 - CDS Nonsynonymous[Phe249Leu]
798 .. 798 G/A rs200645347 - CDS Synonymous[Ser256Ser]
808 .. 808 C/A rs142937236 - CDS Nonsynonymous[Pro260Thr]
819 .. 819 A/G rs147546267 - CDS Synonymous[Glu263Glu]
830 .. 830 C/T rs140713422 - CDS Nonsynonymous[Thr267Ile]
856 .. 856 C/A rs201588267 - CDS Nonsynonymous[Pro276Thr]
895 .. 895 C/G rs61757373 - CDS Nonsynonymous[Pro289Ala]
896 .. 896 C/G rs149593454 - CDS Nonsynonymous[Pro289Arg]
898 .. 898 A/G rs201988795 - CDS Nonsynonymous[Met290Val]
908 .. 908 C/G rs191743893 - CDS Nonsynonymous[Pro293Arg]
921 .. 921 A/T rs1064407 + CDS Synonymous[Ser297Ser]
967 .. 967 G/A rs34515238 - CDS Nonsynonymous[Val313Ile]
1018 .. 1018 A/G rs200321599 - CDS Nonsynonymous[Thr330Ala]
1098 .. 1098 A/G rs150183128 - CDS Synonymous[Ala356Ala]
1129 .. 1129 A/G rs140752697 - CDS Nonsynonymous[Met367Val]
1234 .. 1234 G/A rs143483247 - CDS Nonsynonymous[Val402Met]
1363 .. 1363 C/T rs77137072 - 3'UTR
1366 .. 1366 A/C rs140938481 - 3'UTR
1381 .. 1381 A/T rs4951246 - 3'UTR
1383 .. 1383 T/A rs147692178 - 3'UTR
1387 .. 1387 T/G rs4951016 - 3'UTR
1388 .. 1388 C/T rs111601250 - 3'UTR
1389 .. 1389 G/T rs4951015 - 3'UTR
1418 .. 1418 G/T rs112750957 - 3'UTR
1426 .. 1426 T/C rs186502808 - 3'UTR
1509 .. 1509 C/T rs117852950 - 3'UTR
1544 .. 1544 T/G rs142151444 - 3'UTR
1567 .. 1567 A/G rs3789461 + 3'UTR
1685 .. 1685 A/G rs113980333 - 3'UTR
1771 .. 1771 C/A rs75018839 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
Type Start End Strand
L1PB2 1708 1793 +
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer