H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000261406 Accession number: BC064486 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Protein RRP5 homolog.
 
 

Motif information
ORF

length(1434),orf(81:4384)
MANLEESFPRGGTRKIHKPEKAFQQSVEQDNLFDISTEEGSTKRKKSQKG
PAKTKKLKIEKRESSKSAREKFEILSVESLCEGMRILGCVKEVNELELVI
SLPNGLQGFVQVTEICDAYTKKLNEQVTQEQPLKDLLHLPELFSPGMLVR
CVVSSLGITDRGKKSVKLSLNPKNVNRVLSAEALKPGMLLTGTVSSLEDH
GYLVDIGVDGTRAFLPLLKAQEYIRQKNKGAKLKVGQYLNCIVEKVKGNG
GVVSLSVGHSEVSTAIATEQQSWNLNNLLPGLVVKAQVQKVTPFGLTLNF
LTFFTGVVDFMHLDPKKAGTYFSNQAVRACILCVHPRTRVVHLSLRPIFL
QPGRPLTRLSCQNLGAVLDDVPVQGFFKKAGATFRLKDGVLAYARLSHLS
DSKNVFNPEAFKPGNTHKCRIIDYSQMDELALLSLRTSIIEAQYLRYHDI
EPGAVVKGTVLTIKSYGMLVKVGEQMRGLVPPMHLADILMKNPEKKYHIG
DEVKCRVLLCDPEAKKLMMTLKKTLIESKLPVITCYADAKPGLQTHGFII
RVKDYGCIVKFYNNVQGLVPKHELSTEYIPDPERVFYTGQVVKVVVLNCE
PSKERMLLSFKLSSDPEPKKEPAGHSQKKGKAINIGQLVDVKVLEKTKDG
LEVAVLPHNIRAFLPTSHLSDHVANGPLLHHWLQAGDILHRVLCLSQSEG
RVLLCRKPALVSTVEGGQDPKNFSEIHPGMLLIGFVKSIKDYGVFIQFPS
GLSGLAPKAIMSDKFVTSTSDHFVEGQTVAAKVTNVDEEKQRMLLSLRLS
DCGLGDLAITSLLLLNQCLEELQGVRSLMSNRDSVLIQTLAEMTPGMFLD
LVVQEVLEDGSVVFSGGPVPDLVLKASRYHRAGQEVESGQKKKVVILNVD
LLKLEVHVSLHQDLVNRKARKLRKGSEHQAIVQHLEKSFAIASLVETGHL
AAFSLTSHLNDTFRFDSEKLQVGQGVSLTLKTTEPGVTGLLLAVEGPAAK
...
a.a.
length
InterPro Name
length(102), motif(73:174) 102 IPR012340 Nucleic acid-binding, OB-fold [Domain]
length(100), motif(76:175) 100 IPR012340 Nucleic acid-binding, OB-fold [Domain]
length(91), motif(81:171) 91 IPR022967 RNA-binding domain, S1 [Domain]
length(89), motif(83:171) 89 IPR003029 Ribosomal protein S1, RNA-binding domain [Domain]
length(116), motif(168:283) 116 IPR012340 Nucleic acid-binding, OB-fold [Domain]
length(82), motif(179:260) 82 IPR012340 Nucleic acid-binding, OB-fold [Domain]
length(74), motif(185:258) 74 IPR022967 RNA-binding domain, S1 [Domain]
length(73), motif(185:257) 73 IPR003029 Ribosomal protein S1, RNA-binding domain [Domain]
length(72), motif(187:258) 72 IPR003029 Ribosomal protein S1, RNA-binding domain [Domain]
length(87), motif(267:353) 87 IPR012340 Nucleic acid-binding, OB-fold [Domain]
length(79), motif(270:348) 79 IPR012340 Nucleic acid-binding, OB-fold [Domain]
length(68), motif(279:346) 68 IPR022967 RNA-binding domain, S1 [Domain]
length(66), motif(281:346) 66 IPR003029 Ribosomal protein S1, RNA-binding domain [Domain]
length(74), motif(363:436) 74 IPR022967 RNA-binding domain, S1 [Domain]
length(72), motif(365:436) 72 IPR003029 Ribosomal protein S1, RNA-binding domain [Domain]
length(89), motif(441:529) 89 IPR012340 Nucleic acid-binding, OB-fold [Domain]
length(80), motif(445:524) 80 IPR012340 Nucleic acid-binding, OB-fold [Domain]
length(72), motif(451:522) 72 IPR022967 RNA-binding domain, S1 [Domain]
length(72), motif(451:522) 72 IPR003029 Ribosomal protein S1, RNA-binding domain [Domain]
length(70), motif(453:522) 70 IPR003029 Ribosomal protein S1, RNA-binding domain [Domain]
length(84), motif(534:617) 84 IPR012340 Nucleic acid-binding, OB-fold [Domain]
length(80), motif(536:615) 80 IPR012340 Nucleic acid-binding, OB-fold [Domain]
length(72), motif(540:611) 72 IPR022967 RNA-binding domain, S1 [Domain]
length(70), motif(542:611) 70 IPR003029 Ribosomal protein S1, RNA-binding domain [Domain]
length(64), motif(547:610) 64 IPR003029 Ribosomal protein S1, RNA-binding domain [Domain]
length(84), motif(627:710) 84 IPR012340 Nucleic acid-binding, OB-fold [Domain]
length(80), motif(631:710) 80 IPR012340 Nucleic acid-binding, OB-fold [Domain]
length(74), motif(634:707) 74 IPR022967 RNA-binding domain, S1 [Domain]
length(72), motif(636:707) 72 IPR003029 Ribosomal protein S1, RNA-binding domain [Domain]
length(83), motif(719:801) 83 IPR012340 Nucleic acid-binding, OB-fold [Domain]
length(78), motif(721:798) 78 IPR012340 Nucleic acid-binding, OB-fold [Domain]
length(72), motif(727:798) 72 IPR022967 RNA-binding domain, S1 [Domain]
length(71), motif(728:798) 71 IPR003029 Ribosomal protein S1, RNA-binding domain [Domain]
length(70), motif(729:798) 70 IPR003029 Ribosomal protein S1, RNA-binding domain [Domain]
length(68), motif(844:911) 68 IPR022967 RNA-binding domain, S1 [Domain]
length(76), motif(1029:1104) 76 IPR012340 Nucleic acid-binding, OB-fold [Domain]
length(63), motif(1032:1094) 63 IPR012340 Nucleic acid-binding, OB-fold [Domain]
length(76), motif(1034:1109) 76 IPR022967 RNA-binding domain, S1 [Domain]
length(61), motif(1035:1095) 61 IPR003029 Ribosomal protein S1, RNA-binding domain [Domain]
length(74), motif(1036:1109) 74 IPR003029 Ribosomal protein S1, RNA-binding domain [Domain]
length(87), motif(1136:1222) 87 IPR012340 Nucleic acid-binding, OB-fold [Domain]
length(79), motif(1143:1221) 79 IPR012340 Nucleic acid-binding, OB-fold [Domain]
length(76), motif(1147:1222) 76 IPR022967 RNA-binding domain, S1 [Domain]
length(74), motif(1149:1222) 74 IPR003029 Ribosomal protein S1, RNA-binding domain [Domain]
length(88), motif(1225:1312) 88 IPR012340 Nucleic acid-binding, OB-fold [Domain]
length(77), motif(1226:1302) 77 IPR012340 Nucleic acid-binding, OB-fold [Domain]
length(71), motif(1228:1298) 71 IPR022967 RNA-binding domain, S1 [Domain]
length(69), motif(1230:1298) 69 IPR003029 Ribosomal protein S1, RNA-binding domain [Domain]
length(91), motif(1305:1395) 91 IPR012340 Nucleic acid-binding, OB-fold [Domain]
length(89), motif(1310:1398) 89 IPR012340 Nucleic acid-binding, OB-fold [Domain]
length(75), motif(1322:1396) 75 IPR022967 RNA-binding domain, S1 [Domain]
length(73), motif(1324:1396) 73 IPR003029 Ribosomal protein S1, RNA-binding domain [Domain]