H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000261449 Accession number: BC064530 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Zinc finger protein 638; Cutaneous T-cell lymphoma-associated antigen se33-1; CTCL-associated antigen se33-1; Nuclear protein 220; Zinc finger matrin-like protein;
 
 

Motif information
ORF

length(482),orf(48:1494)
MSRPRFNPRGDFPLQRPRAPNPSGMRPPGPFMRPGSMGLPRFYPAGRARG
IPHRFAGHESYQNMGPQRMNVQVTQHRTDPRLTKEKLDFHEAQQKKGKPH
GSRWDDEPHISASVAVKQSSVTQVTEQSPKVQSRYTKESASSILASFGLS
NEDLEELSRYPDEQLTPENMPLILRDIRMRKMGRRLPNLPSQSRNKETLG
SEAVSSNVIDYGHASKYGYTEDPLEVRIYDPEIPTDEVENEFQSQQNISA
SVPNPNVICNSMFPVEDVFRQMDFPGESSNNRSFFSVESGTKMSGLHISG
GQSVLEPIKSVNQSINQTVSQTMSQSLIPPSMNQQPFSSELISSVSQQER
IPHEPVINSSNVHVGSRGSKKNYQSQADIPIRSPFGIVKASWLPKFSHAD
AQKMKRLPTPSMMNDYYAASPRIFPHLCSLCNVECSHLKDWIQHQNTSTH
IESCRQLRQQYPDWNPEILPSRRNEGNRKKKK
a.a.
length
InterPro Name
length(25), motif(426:450) 25 IPR015880 Zinc finger, C2H2-like [Domain]