H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000261801 Accession number: BC065238 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Protein enabled homolog isoform a.
 
 

Motif information
ORF

length(527),orf(1:1584)
NTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGS
KEDANVFASAMMHALEVLNSQETGPTLPRQNSQLPAQVQNGPSQEELEIQ
RRQLQEQQRQKELERERLERERMERERLERERLERERLERERLEQEQLER
ERQERERQERLERQERLERQERLERQERLDRERQERQERERLERLERERQ
ERERQEQLEREQLEWERERRISSAAAPASVETPLNSVLGDSSASEPGLQA
ASQPAETPSQQGIVLGPLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLP
STGPPPPPPPPPLPNQVPPPPPPPPAPPLPASGFFLASMSEDNRPLTGLA
AAIAGAKLRKVSRMEDTSFPSGGNAIGVNSASSKTDTGRGNGPLPLGGSG
LMEEMSALLARRRRIAEKGSTIETEQKEDKGEDSEPVTSKASSTSTPEPT
RKPWERTNTMNGSKSPVISRPKSTPLSQPSANGVQTEGLDYDRLKQDILD
EMRKELTKLKEELIDAIRQELSKSNTA*
a.a.
length
InterPro Name
length(71), motif(1:71) 71 IPR011993 Pleckstrin homology-like domain [Domain]
length(68), motif(1:68) 68 IPR000697 WH1/EVH1 domain [Domain]
length(64), motif(1:64) 64 IPR000697 WH1/EVH1 domain [Domain]
length(40), motif(487:526) 40 IPR014885 VASP tetramerisation [Domain]