H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000262090 Accession number: BC065912 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Abelson tyrosine-protein kinase 2 isoform g.
 
 

Motif information
ORF

length(1167),orf(13:3516)
MVLGTVLLPPNSYGRDQDTSLCCLCTEASESALPDLTDHFASCVEDGFEG
DKTGGSSPEALHRPYGCDVEPQALNEAIRWSSKENLLGATESDPNLFVAL
YDFVASGDNTLSITKGEKLRVLGYNQNGEWSEVRSKNGQGWVPSNYITPV
NSLEKHSWYHGPVSRSAAEYLLSSLINGSFLVRESESSPGQLSISLRYEG
RVYHYRINTTADGKVYVTAESRFSTLAELVHHHSTVADGLVTTLHYPAPK
CNKPTVYGVSPIHDKWEMERTDITMKHKLGGGQYGEVYVGVWKKYSLTVA
VKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTLEPPFYIVTEYMP
YGNLLDYLRECNREEVTAVVLLYMATQISSAMEYLEKKNFIHRDLAARNC
LVGENHVVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNTFSIK
SDVWAFGVLLWEIATYGMSPYPGIDLSQVYDLLEKGYRMEQPEGCPPKVY
ELMRACWKWSPADRPSFAETHQAFETMFHDSSISEEVAEELGRAASSSSV
VPYLPRLPILPSKTRTLKKQVENKENIEGAQDATENSASSLAPGFIRGAQ
ASSGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSFMKKRNAPTP
PKRSSSFREMENQPHKKYELTGNFSSVASLQHADGFSFTPAQQEANLVPP
KCYGGSFAQRNLCNDDGGGGGGSGTAGGGWSGITGFFTPRLIKKTLGLRA
GKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERT
VSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGATALPLRTP
SGDLAITEKDPPGVGVAGVAAAPKGKEKNGGARLGMAGVPEDGEQPGWPS
PAKAAPVLPTTHNHKVPVLISPTLKHTPADVQLIGTDSQGNKFKLLSEHQ
VTSSGDKDRPRRVKPKCAPPPPPVMRLLQHPSICSDPTEEPTALTAGQST
...
a.a.
length
InterPro Name
length(61), motif(92:152) 61 IPR001452 SH3 domain [Domain]
length(86), motif(93:178) 86 IPR001452 SH3 domain [Domain]
length(57), motif(95:151) 57 IPR001452 SH3 domain [Domain]
length(47), motif(98:144) 47 IPR001452 SH3 domain [Domain]
length(120), motif(150:269) 120 IPR000980 SH2 domain [Domain]
length(141), motif(153:293) 141 IPR000980 SH2 domain [Domain]
length(84), motif(156:239) 84 IPR000980 SH2 domain [Domain]
length(91), motif(158:248) 91 IPR000980 SH2 domain [Domain]
length(76), motif(158:233) 76 IPR000980 SH2 domain [Domain]
length(15), motif(158:172) 15 IPR000980 SH2 domain [Domain]
length(11), motif(177:187) 11 IPR000980 SH2 domain [Domain]
length(12), motif(189:200) 12 IPR000980 SH2 domain [Domain]
length(11), motif(201:211) 11 IPR000980 SH2 domain [Domain]
length(15), motif(222:236) 15 IPR000980 SH2 domain [Domain]
length(273), motif(264:536) 273 IPR011009 Protein kinase-like domain [Domain]
length(252), motif(273:524) 252 IPR020635 Tyrosine-protein kinase, catalytic domain [Domain]
length(251), motif(273:523) 251 IPR001245 Serine-threonine/tyrosine-protein kinase catalytic domain [Domain]
length(252), motif(273:524) 252 IPR000719 Protein kinase domain [Domain]
length(24), motif(279:302) 24 IPR017441 Protein kinase, ATP binding site [Binding_site]
length(14), motif(346:359) 14 IPR001245 Serine-threonine/tyrosine-protein kinase catalytic domain [Domain]
length(19), motif(384:402) 19 IPR001245 Serine-threonine/tyrosine-protein kinase catalytic domain [Domain]
length(13), motif(390:402) 13 IPR008266 Tyrosine-protein kinase, active site [Active_site]
length(11), motif(432:442) 11 IPR001245 Serine-threonine/tyrosine-protein kinase catalytic domain [Domain]
length(23), motif(451:473) 23 IPR001245 Serine-threonine/tyrosine-protein kinase catalytic domain [Domain]
length(23), motif(495:517) 23 IPR001245 Serine-threonine/tyrosine-protein kinase catalytic domain [Domain]
length(122), motif(1046:1167) 122 IPR015015 F-actin binding [Domain]
length(103), motif(1065:1167) 103 IPR015015 F-actin binding [Domain]