H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000262118 Accession number: BC066121 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Probable G-protein coupled receptor 116; Precursor;
 
 

Transcript original information
Accession number BC066121.1
CAGE tag ID NA
EST ID NA
Clone Number MGC:71511 IMAGE:5298732
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (GPR116) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (GPR116);
Sequence data provider NA
Annotation project NA
Length of cDNA 5514[bp] (No. of exon:21)[A:1619 T:1516 G:1179 C:1200]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Testis
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 5499(+) Signal: 5476-5480(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0005939
Genomic location  G-integra Help Chromosome 6
Location 6p12.3
Position 46820338- 46882866
Strand -
Possible duplicated location(s) NA
Gene structure 21 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:221395
KEGG GENES KEGG GENES(221395)
GeneCard GeneCardGPR116*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000056725
Predicted CDS 26..4108;  1360[aa];  Orientation:+2; 
Codon Adaptation Index (CAI). 0.748

Motif information
ORF

length(1360),orf(26:4108)
MGGSLEANQLKLEDMKSPRRTTLCLMFIVIYSSKAALNWNYESTIHPLSL
HEHEPAGEEALRQKRAVATKSPTAEEYTVNIEISFENASFLDPIKAYLNS
LSFPIHGNNTDQITDILSINVTTVCRPAGNEIWCSCETGYGWPRERCLHN
LICQERDVFLPGHHCSCLKELPPNGPFCLLQEDVTLNMRVRLNVGFQEDL
MNTSSALYRSYKTDLETAFRKGYGILPGFKGVTVTGFKSGSVVVTYEVKT
TPPSLELIHKANEQVVQSLNQTYKMDYNSFQAVTINESNFFVTPEIIFEG
DTVSLVCEKEVLSSNVSWRYEEQQLEIQNSSRFSIYTALFNNMTSVSKLT
IHNITPGDAGEYVCKLILDIFEYECKKKIDVMPIQILANEEMKVMCDNNP
VSLNCCSQGNVNWSKVEWKQEGKINIPGTPETDIDSSCSRYTLKADGTQC
PSGSSGTTVIYTCEFISAYGARGSANIKVTFISVANLTITPDPISVSEGQ
NFSIKCISDVSNYDEVYWNTSAGIKIYQRFYTTRRYLDGAESVLTVKTST
REWNGTYHCIFRYKNSYSIATKDVIVHPLPLKLNIMVDPLEATVSCSGSH
HIKCCIEEDGDYKVTFHMGSSSLPAAKEVNKKQVCYKHNFNASSVSWCSK
TVDVCCHFTNAANNSVWSPSMKLNLVPGENITCQDPVIGVGEPGKVIQKL
CRFSNVPSSPESPIGGTITYKCVGSQWEEKRNDCISAPINSLLQMAKALI
KSPSQDEMLPTYLKDLSISIDKAEHEISSSPGSLGAIINILDLLSTVPTQ
VNSEMMTHVLSTVNVILGKPVLNTWKVLQQQWTNQSSQLLHSVERFSQAL
QSGDSPPLSFSQTNVQMSSTVIKSSHPETYQQRFVFPYFDLWGNVVIDKS
YLENLQSDSSIVTMAFPTLQAILAQDIQENNFAESLVMTTTVSHNTTMPF
RISMTFKNNSPSGGETKCVFWNFRLANNTGGWDSSGCYVEEGDGDNVTCI
...
a.a.
length
InterPro Name
length(19), motif(74:92) 19 IPR008078 GPCR, family 2, Ig-hepta receptor [Family]
length(26), motif(153:178) 26 IPR008078 GPCR, family 2, Ig-hepta receptor [Family]
length(115), motif(182:296) 115 IPR000082 SEA domain [Domain]
length(96), motif(183:278) 96 IPR000082 SEA domain [Domain]
length(110), motif(184:293) 110 IPR000082 SEA domain [Domain]
length(86), motif(281:366) 86 IPR007110 Immunoglobulin-like domain [Domain]
length(84), motif(297:380) 84 IPR013783 Immunoglobulin-like fold [Domain]
length(74), motif(298:371) 74 IPR003598 Immunoglobulin subtype 2 [Domain]
length(68), motif(299:366) 68 IPR013098 Immunoglobulin I-set [Domain]
length(98), motif(383:480) 98 IPR007110 Immunoglobulin-like domain [Domain]
length(18), motif(390:407) 18 IPR008078 GPCR, family 2, Ig-hepta receptor [Family]
length(27), motif(412:438) 27 IPR008078 GPCR, family 2, Ig-hepta receptor [Family]
length(25), motif(441:465) 25 IPR008078 GPCR, family 2, Ig-hepta receptor [Family]
length(91), motif(485:575) 91 IPR007110 Immunoglobulin-like domain [Domain]
length(82), motif(487:568) 82 IPR013783 Immunoglobulin-like fold [Domain]
length(87), motif(491:577) 87 IPR003599 Immunoglobulin subtype [Domain]
length(22), motif(680:701) 22 IPR008078 GPCR, family 2, Ig-hepta receptor [Family]
length(14), motif(714:727) 14 IPR008078 GPCR, family 2, Ig-hepta receptor [Family]
length(53), motif(964:1016) 53 IPR000203 GPS motif [Domain]
length(52), motif(965:1016) 52 IPR000203 GPS motif [Domain]
length(47), motif(965:1011) 47 IPR000203 GPS motif [Domain]
length(259), motif(1026:1284) 259 IPR017981 GPCR, family 2-like [Domain]
length(251), motif(1026:1276) 251 IPR000832 GPCR, family 2, secretin-like [Family]
length(25), motif(1028:1052) 25 IPR000832 GPCR, family 2, secretin-like [Family]
length(13), motif(1052:1064) 13 IPR008078 GPCR, family 2, Ig-hepta receptor [Family]
length(24), motif(1102:1125) 24 IPR000832 GPCR, family 2, secretin-like [Family]
length(17), motif(1126:1142) 17 IPR008078 GPCR, family 2, Ig-hepta receptor [Family]
length(18), motif(1168:1185) 18 IPR008078 GPCR, family 2, Ig-hepta receptor [Family]
length(26), motif(1187:1212) 26 IPR000832 GPCR, family 2, secretin-like [Family]
length(18), motif(1213:1230) 18 IPR008078 GPCR, family 2, Ig-hepta receptor [Family]
length(21), motif(1231:1251) 21 IPR000832 GPCR, family 2, secretin-like [Family]
length(22), motif(1262:1283) 22 IPR000832 GPCR, family 2, secretin-like [Family]
length(16), motif(1272:1287) 16 IPR017983 GPCR, family 2, secretin-like, conserved site [Conserved_site]
length(27), motif(1286:1312) 27 IPR008078 GPCR, family 2, Ig-hepta receptor [Family]
length(25), motif(1314:1338) 25 IPR008078 GPCR, family 2, Ig-hepta receptor [Family]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000262118
H-Inv cluster ID Locus viewHIX0005939
Accession number BC066121.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Probable G-protein coupled receptor 116; Precursor;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (Q8IZF2)  [Identity/coverage = 99.851%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 10048485124355841267951714574404154893341633595217974005ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol GPR116
HGNC aliases NA
HGNC name G protein-coupled receptor 116
DDBJ GPR116
UniProt GPR116
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000056725
No. of interaction NA
Interaction partner(s) NA
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:221395
KEGG GENES KEGG GENES(221395)
GeneCard GeneCardGPR116*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function transmembrane receptor activity (GO:0004888);  protein binding (GO:0005515);  G-protein coupled receptor activity (GO:0004930); 
Biological process G-protein coupled receptor protein signaling pathway (GO:0007186);  cell surface receptor linked signal transduction (GO:0007166); 
Cellular component integral to membrane (GO:0016021);  membrane (GO:0016020); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT plasma membrane; 
Target P Other
SOSUI membrane protein
TMHMM membrane protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
185 288 1ivzA 7e-12 21.4 103/132 d.58.41.1
299 386 1olzA1 2e-06 16.7 79/91 b.1.1.4
487 580 2cqvA1 5e-08 15.2 92/101 b.1.1.4
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsB090513;  AGhsB131621; 
Affymetrix
GeneChip
HG-Focus NA
HG-U133 212950_at;  212951_at; 
HG-U133A 212950_at;  212951_at; 
HG-U133A_2 212950_at;  212951_at; 
HG-U133B NA
HG-U133_Plus_2 212950_at;  212951_at; 
HG-U95 34235_at; 
HG-U95A 34235_at; 
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 2909292;  2909294;  2955865;  2955866;  2955867;  2955868;  2955872;  2955873;  2955874;  2955875;  2955876;  2955877;  2955878;  2955879;  2955881;  2955884;  2955885;  2955887;  2955892;  2955898;  2955899;  2955900;  2955904;  2955906;  2955908;  2955909;  2955910;  2955911;  2955916;  2955917;  2955921;  2955923;  3172054;  3172055;  3172056;  3172335;  3172336;  3172549;  3172568;  3207017;  3207264;  3207265;  3207266;  3207387;  3207389;  3207390;  3207391;  3207392; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 A_23_P252874; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P252874;  A_23_P424710;  A_24_P299469; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
55 .. 55 C/G rs201268117 - CDS Synonymous[Leu10Leu]
107 .. 107 A/G rs200005287 - CDS Nonsynonymous[Ile28Val]
149 .. 149 G/A rs139944654 - CDS Nonsynonymous[Glu42Lys]
165 .. 165 C/A rs201929281 - CDS Nonsynonymous[Pro47His]
199 .. 199 A/G rs113814630 - CDS Synonymous[Glu58Glu]
212 .. 212 C/A rs78296467 - CDS Nonsynonymous[Gln63Lys]
219 .. 219 G/A rs138615507 - CDS Nonsynonymous[Arg65Gln]
222 .. 222 C/T rs191044850 - CDS Nonsynonymous[Ala66Val]
223 .. 223 C/T rs200874020 - CDS Synonymous[Ala66Ala]
224 .. 224 G/A rs145334563 - CDS Nonsynonymous[Val67Ile]
239 .. 239 C/T rs139856813 - CDS Nonsynonymous[Pro72Ser]
348 .. 348 A/G rs147464998 - CDS Nonsynonymous[Asn108Ser]
362 .. 362 A/G rs143107263 - CDS Nonsynonymous[Ile113Val]
367 .. 367 C/T rs678312 + CDS Synonymous[Thr114Thr]
422 .. 422 T/C rs143999232 - CDS Nonsynonymous[Trp133Arg]
424 .. 424 G/C rs149511712 - CDS Nonsynonymous[Trp133Cys]
433 .. 433 C/T rs138073254 - CDS Synonymous[Cys136Cys]
455 .. 455 C/T rs145580781 - CDS Nonsynonymous[Arg144Trp]
463 .. 463 G/A rs141885100 - CDS Synonymous[Arg146Arg]
491 .. 491 C/T rs138516675 - CDS Nonsynonymous[Arg156Cys]
511 .. 511 G/T/A rs144628829 - CDS
536 .. 536 C/T rs199548486 - CDS Synonymous[Leu171Leu]
546 .. 546 A/G rs115136473 - CDS Nonsynonymous[Asn174Ser]
548 .. 548 G/A rs146789315 - CDS Nonsynonymous[Gly175Arg]
609 .. 609 G/A rs150959951 - CDS Nonsynonymous[Gly195Asp]
615 .. 615 A/G rs202119083 - CDS Nonsynonymous[Gln197Arg]
640 .. 640 C/T rs143316442 - CDS Synonymous[Ser205Ser]
641 .. 641 G/A rs149197213 - CDS Nonsynonymous[Ala206Thr]
679 .. 679 G/A rs78333594 - CDS Synonymous[Ala218Ala]
688 .. 688 G/A rs145639403 - CDS Synonymous[Lys221Lys]
694 .. 694 C/T rs140241968 - CDS Synonymous[Tyr223Tyr]
695 .. 695 G/A rs147874364 - CDS Nonsynonymous[Gly224Arg]
709 .. 709 C/T rs200496823 - CDS Synonymous[Gly228Gly]
718 .. 718 C/T rs202152357 - CDS Synonymous[Gly231Gly]
794 .. 794 T/C rs144630403 - CDS Synonymous[Leu257Leu]
941 .. 941 G/T rs192560047 - CDS Nonsynonymous[Val306Leu]
963 .. 963 C/T rs201263107 - CDS Nonsynonymous[Ser313Phe]
981 .. 981 G/A rs139730967 - CDS Nonsynonymous[Arg319His]
1036 .. 1036 C/T rs150647239 - CDS Synonymous[Thr337Thr]
1059 .. 1059 C/T rs199931272 - CDS Nonsynonymous[Ser345Leu]
1060 .. 1060 G/A rs141718692 - CDS Synonymous[Ser345Ser]
1073 .. 1073 A/C rs76658105 - CDS Nonsynonymous[Thr350Pro]
1076 .. 1076 A/G rs202040944 - CDS Nonsynonymous[Ile351Val]
1085 .. 1085 A/G rs199555725 - CDS Nonsynonymous[Ile354Val]
1091 .. 1091 C/T rs148450798 - CDS Nonsynonymous[Pro356Ser]
1095 .. 1095 G/T rs201468882 - CDS Nonsynonymous[Gly357Val]
1097 .. 1097 G/A rs146250899 - CDS Nonsynonymous[Asp358Asn]
1104 .. 1104 G/A rs200539613 - CDS Nonsynonymous[Gly360Asp]
1203 .. 1203 A/T rs41273668 - CDS Nonsynonymous[Lys393Met]
1285 .. 1285 G/A rs138779256 - CDS Synonymous[Gln420Gln]
1304 .. 1304 C/A rs191079165 - CDS Nonsynonymous[Pro427Thr]
1311 .. 1311 C/A rs144571563 - CDS Nonsynonymous[Thr429Asn]
1313 .. 1313 C/G rs149458418 - CDS Nonsynonymous[Pro430Ala]
1359 .. 1359 C/T rs77392151 - CDS Nonsynonymous[Ala445Val]
1371 .. 1371 A/T rs201880878 - CDS Nonsynonymous[Gln449Leu]
1407 .. 1407 A/G rs201798710 - CDS Nonsynonymous[Tyr461Cys]
1498 .. 1498 G/A rs150327469 - CDS Synonymous[Pro491Pro]
1549 .. 1549 T/C rs114116756 - CDS Synonymous[Ser508Ser]
1572 .. 1572 T/C rs147719014 - CDS Nonsynonymous[Val516Ala]
1604 .. 1604 T/C rs112491454 - CDS Nonsynonymous[Tyr527His]
1646 .. 1646 G/A rs141815815 - CDS Nonsynonymous[Glu541Lys]
1661 .. 1661 G/A rs199683187 - CDS Nonsynonymous[Val546Ile]
1699 .. 1699 C/T rs199751206 - CDS Synonymous[His558His]
1717 .. 1717 G/T rs147958492 - CDS Nonsynonymous[Lys564Asn]
1741 .. 1741 A/G rs142259614 - CDS Synonymous[Lys572Lys]
1758 .. 1758 C/G rs149143085 - CDS Nonsynonymous[Pro578Arg]
1759 .. 1759 G/A rs145214557 - CDS Synonymous[Pro578Pro]
1775 .. 1775 A/C rs202045429 - CDS Nonsynonymous[Asn584His]
1828 .. 1828 C/T rs182260273 - CDS Synonymous[His601His]
1869 .. 1869 C/T rs150003216 - CDS Nonsynonymous[Thr615Ile]
1878 .. 1878 T/C rs586024 + CDS Nonsynonymous[Met618Thr]
1892 .. 1892 C/T rs146239972 - CDS Nonsynonymous[Leu623Phe]
2023 .. 2023 T/C rs614826 + CDS Synonymous[Val666Val]
2083 .. 2083 C/T rs139946395 - CDS Synonymous[Pro686Pro]
2084 .. 2084 G/A rs201326559 - CDS Nonsynonymous[Val687Ile]
2104 .. 2104 G/A rs144652122 - CDS Synonymous[Pro693Pro]
2140 .. 2140 C/T rs201435302 - CDS Synonymous[Asn705Asn]
2151 .. 2151 G/C rs141610704 - CDS Nonsynonymous[Ser709Thr]
2166 .. 2166 T/C rs147975526 - CDS Nonsynonymous[Ile714Thr]
2175 .. 2175 C/G rs144467386 - CDS Nonsynonymous[Thr717Ser]
2201 .. 2201 C/A rs199658359 - CDS Nonsynonymous[Gln726Lys]
2254 .. 2254 C/G rs2273266 + CDS Synonymous[Leu743Leu]
2344 .. 2344 G/A rs149269256 - CDS Synonymous[Ala773Ala]
2446 .. 2446 G/A rs182227253 - CDS Synonymous[Thr807Thr]
2450 .. 2450 G/A rs200270176 - CDS Nonsynonymous[Val809Met]
2468 .. 2468 G/A rs9395218 - CDS Nonsynonymous[Val815Ile]
2470 .. 2470 C/T rs200056704 - CDS Synonymous[Val815Val]
2479 .. 2479 C/G rs12374606 - CDS Synonymous[Gly818Gly]
2481 .. 2481 A/T rs147076717 - CDS Nonsynonymous[Lys819Met]
2572 .. 2572 A/G rs180960579 - CDS Synonymous[Ala849Ala]
2573 .. 2573 T/C rs12374645 - CDS Synonymous[Leu850Leu]
2579 .. 2579 T/C rs141776519 - CDS Nonsynonymous[Ser852Pro]
2581 .. 2581 A/G rs610856 + CDS Synonymous[Ser852Ser]
2612 .. 2612 A/G rs200248669 - CDS Nonsynonymous[Thr863Ala]
2613 .. 2613 C/T rs150267672 - CDS Nonsynonymous[Thr863Ile]
2621 .. 2621 C/A rs201123540 - CDS Nonsynonymous[Gln866Lys]
2634 .. 2634 C/T rs547499 + CDS Nonsynonymous[Thr870Met]
2687 .. 2687 T/A rs201982496 - CDS Nonsynonymous[Tyr888Asn]
2728 .. 2728 T/C rs9381487 - CDS Synonymous[Tyr901Tyr]
2751 .. 2751 C/T rs200599117 - CDS Nonsynonymous[Ser909Leu]
2752 .. 2752 G/A rs116032245 - CDS Synonymous[Ser909Ser]
2797 .. 2797 T/C rs611779 + CDS Synonymous[Ala924Ala]
2826 .. 2826 A/G rs146816496 - CDS Nonsynonymous[Glu934Gly]
2847 .. 2847 C/T rs143344736 - CDS Nonsynonymous[Thr941Ile]
2863 .. 2863 G/A rs571247 + CDS Synonymous[Thr946Thr]
2896 .. 2896 G/A rs144073167 - CDS Synonymous[Lys957Lys]
2914 .. 2914 C/T rs113672203 - CDS Synonymous[Gly963Gly]
2918 .. 2918 G/A rs139221728 - CDS Nonsynonymous[Glu965Lys]
2942 .. 2942 T/C rs201196893 - CDS Nonsynonymous[Phe973Leu]
2992 .. 2992 T/A rs572248 + CDS Synonymous[Val989Val]
3004 .. 3004 T/C rs141152676 - CDS Synonymous[Asp993Asp]
3006 .. 3006 G/C rs138708426 - CDS Nonsynonymous[Gly994Ala]
3041 .. 3041 T/A rs147171109 - CDS Nonsynonymous[Ser1006Thr]
3061 .. 3061 C/T rs146902862 - CDS Synonymous[Ser1012Ser]
3138 .. 3138 T/C rs143563991 - CDS Nonsynonymous[Ile1038Thr]
3199 .. 3199 T/C rs613870 + CDS Synonymous[Asn1058Asn]
3200 .. 3200 C/T rs200682859 - CDS Nonsynonymous[Arg1059Trp]
3216 .. 3216 G/T rs199576297 - CDS Nonsynonymous[Arg1064Leu]
3238 .. 3238 C/T rs151037028 - CDS Synonymous[Ile1071Ile]
3300 .. 3300 G/A rs143364971 - CDS Nonsynonymous[Arg1092His]
3307 .. 3307 A/G rs149215108 - CDS Nonsynonymous[Ile1094Met]
3314 .. 3314 A/C rs138331843 - CDS Nonsynonymous[Lys1097Gln]
3388 .. 3388 G/C rs150389766 - CDS Synonymous[Leu1121Leu]
3392 .. 3392 C/T rs140532705 - CDS Nonsynonymous[Leu1123Phe]
3430 .. 3430 A/G rs187141120 - CDS Synonymous[Glu1135Glu]
3496 .. 3496 G/A rs142588297 - CDS Synonymous[Ser1157Ser]
3524 .. 3524 C/T rs146806321 - CDS Nonsynonymous[Arg1167Trp]
3525 .. 3525 G/A rs145046261 - CDS Nonsynonymous[Arg1167Gln]
3535 .. 3535 T/C rs201301159 - CDS Synonymous[Tyr1170Tyr]
3537 .. 3537 C/T rs141322343 - CDS Nonsynonymous[Thr1171Met]
3581 .. 3581 C/T rs150981453 - CDS Synonymous[Leu1186Leu]
3586 .. 3586 G/T rs142622587 - CDS Synonymous[Leu1187Leu]
3685 .. 3685 A/G rs148469784 - CDS Synonymous[Pro1220Pro]
3729 .. 3729 T/C rs145650405 - CDS Nonsynonymous[Ile1235Thr]
3730 .. 3730 T/G/C rs182572299 - CDS
3790 .. 3790 A/G rs202208960 - CDS Synonymous[Pro1255Pro]
3868 .. 3868 C/T rs60479672 - CDS Synonymous[Cys1281Cys]
3878 .. 3878 C/A rs199895998 - CDS Nonsynonymous[Leu1285Met]
3909 .. 3909 T/C rs112842147 - CDS Nonsynonymous[Phe1295Ser]
3969 .. 3969 C/T rs201216000 - CDS Nonsynonymous[Pro1315Leu]
4032 .. 4032 C/T rs140284327 - CDS Nonsynonymous[Thr1336Met]
4068 .. 4068 C/T rs147148177 - CDS Nonsynonymous[Ser1348Phe]
4111 .. 4111 A/G rs144111839 - 3'UTR
4130 .. 4130 G/A rs117945872 - 3'UTR
4139 .. 4139 C/T rs201720856 - 3'UTR
4154 .. 4154 T/G rs201165369 - 3'UTR
4154 ^ 4155 -/GGG rs147835950 - 3'UTR
4188 .. 4188 G/T rs181918986 - 3'UTR
4192 .. 4192 G/A rs111543838 - 3'UTR
4200 .. 4200 G/A rs73736670 - 3'UTR
4205 .. 4205 A/T rs185722086 - 3'UTR
4251 .. 4251 G/T rs114838207 - 3'UTR
4404 .. 4404 C/T rs181603689 - 3'UTR
4520 .. 4520 G/A rs220683 + 3'UTR
4557 .. 4557 G/A rs9784 + 3'UTR
4577 .. 4577 A/G rs11754650 - 3'UTR
4585 .. 4585 A/G rs189042152 - 3'UTR
4623 .. 4623 T/C rs59504723 - 3'UTR
4681 .. 4681 T/G rs184682521 - 3'UTR
4752 .. 4752 G/C rs9357518 - 3'UTR
4938 .. 4938 T/C rs10577 + 3'UTR
5213 .. 5213 C/A rs1045791 + 3'UTR
5228 .. 5228 T/C rs141513066 - 3'UTR
5328 .. 5328 G/A rs148337231 - 3'UTR
5459 .. 5459 T/A rs181566640 - 3'UTR
5463 .. 5463 T/- rs3832435 + 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
Type Start End Strand
AluSz6 1 47 +
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer