H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000262813 Accession number: BC067845 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Signal recognition particle 9 kDa protein isoform 2.
 
 

Motif information
ORF

length(82),orf(64:312)
MPQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVRQC
LALLLRLQCSGMIIAHCILDLLGSSGPLASAS*
a.a.
length
InterPro Name
length(49), motif(2:50) 49 IPR009018 Signal recognition particle, SRP9/SRP14 subunit [Domain]
length(46), motif(2:47) 46 IPR008832 Signal recognition particle, SRP9 subunit [Family]
length(45), motif(3:47) 45 IPR009018 Signal recognition particle, SRP9/SRP14 subunit [Domain]