H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000264414 Accession number: BC071585 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to RNA-binding protein 47 isoform a.
 
 

Motif information
ORF

length(393),orf(709:1890)
MTAEDSTAAMSSDSAAGSSAKVPEGVAGAPNEAALLALMERTGYSMVQEN
GQRKYGGPPPGWEGPHPQRGCEVFVGKIPRDVYEDELVPVFEAVGRIYEL
RLMMDFDGKNRGYAFVMYCHKHEAKRAVRELNNYEIRPGRLLGVCCSVDN
CRLFIGGIPKMKKREEILEEIAKVTEGVLDVIVYASAADKMKNRGFAFVE
YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYV
RNLMIETTEDTIKKSFGQFNPGCVERVKKIRDYAFVHFTSREDAVHAMNN
LNGTELEGSCLEVTLAKPVDKEQYSRYQKAARGGGAAEAAQQPSYVYSCD
PYTLAYYGYPYNALIGPNRDYFVKDTILETHPASLPLVLRRHA*
a.a.
length
InterPro Name
length(364), motif(15:378) 364 IPR006535 HnRNP R/Q splicing factor [Family]
length(74), motif(71:144) 74 IPR000504 RNA recognition motif domain [Domain]
length(74), motif(72:145) 74 IPR000504 RNA recognition motif domain [Domain]
length(65), motif(73:137) 65 IPR000504 RNA recognition motif domain [Domain]
length(161), motif(74:234) 161 IPR012677 Nucleotide-binding alpha-beta plait domain [Domain]
length(83), motif(151:233) 83 IPR000504 RNA recognition motif domain [Domain]
length(78), motif(152:229) 78 IPR000504 RNA recognition motif domain [Domain]
length(62), motif(153:214) 62 IPR000504 RNA recognition motif domain [Domain]
length(73), motif(246:318) 73 IPR000504 RNA recognition motif domain [Domain]
length(85), motif(247:331) 85 IPR012677 Nucleotide-binding alpha-beta plait domain [Domain]
length(68), motif(247:314) 68 IPR000504 RNA recognition motif domain [Domain]
length(64), motif(248:311) 64 IPR000504 RNA recognition motif domain [Domain]