H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000265096 Accession number: BC073872 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Opsin-3; Encephalopsin; Panopsin;
 
 

Motif information
ORF

length(142),orf(71:499)
MYSGNRSGGHGYWDGGGAAGAEGPAPAGTLSPAPLFSPGTYERLALLLGS
IGLLGVGNNLLVLVLYYKFQRLRTPTHLLLVNISLSDLLVSLFGVTFTFV
SCLRNGWVWDTVGCVWDGFSGSLFASLCGRSSDNSSDQDFKI*
a.a.
length
InterPro Name
length(88), motif(37:124) 88 IPR017452 GPCR, rhodopsin-like, 7TM [Domain]
length(25), motif(43:67) 25 IPR000276 G protein-coupled receptor, rhodopsin-like [Family]
length(57), motif(58:114) 57 IPR017452 GPCR, rhodopsin-like, 7TM [Domain]
length(58), motif(59:116) 58 IPR000276 G protein-coupled receptor, rhodopsin-like [Family]
length(22), motif(76:97) 22 IPR000276 G protein-coupled receptor, rhodopsin-like [Family]