H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000265606 Accession number: BC075791 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Homeobox protein Hox-A13; Homeobox protein Hox-1J;
 
 

Transcript original information
Accession number BC075791.1
CAGE tag ID NA
EST ID NA
Clone Number MGC:86983 IMAGE:30341785
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ;
Sequence data provider NA
Annotation project NA
Length of cDNA 2453[bp] (No. of exon:2)[A:613 T:587 G:605 C:648]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Placenta, normal
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 2438(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0201189
Genomic location  G-integra Help Chromosome 7
Location 7p15.2
Position 27236577- 27239725
Strand -
Possible duplicated location(s) NA
Gene structure 2 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:3209
KEGG GENES KEGG GENES(3209)
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS;  G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000105531
Predicted CDS 30..1196;  388[aa];  Orientation:+3; 
Codon Adaptation Index (CAI). 0.728

Motif information
ORF

length(388),orf(30:1196)
MTASVLLHPRWIEPTVMFLYDNGGGLVADELNKNMEGAAAAAAAAAAAAA
AGAGGGGFPHPAAAAAGGNFSVAAAAAAAAAAAANQCRNLMAHPAPLAPV
AASAYSSAPGEAPPSAAAAAAAAAAAAAAAAAASSSGGPGPAGPAGAEAA
KQCSPCSAAAQSSSGPAALPYGYFGSGYYPCARMGPHPNAIKSCAQPASA
AAAAAFADKYMDTAGPAAEEFSSRAKEFAFYHQGYAAGPYHHHQPMPGYL
DMPVVPGLGGPGESRHEPLGLPMESYQPWALPNGWNGQMYCPKEQAQPPH
LWKSTLPDVVSHPSDASSYRRGRKKRVPYTKVQLKELEREYATNKFITKD
KRRRISATTNLSERQVTIWFQNRRVKEKKVINKLKTTS*
a.a.
length
InterPro Name
length(57), motif(79:135) 57 IPR022067 Homeobox protein Hox1A3 N-terminal [Domain]
length(101), motif(124:224) 101 IPR022067 Homeobox protein Hox1A3 N-terminal [Domain]
length(77), motif(303:379) 77 IPR009057 Homeodomain-like [Domain]
length(69), motif(312:380) 69 IPR009057 Homeodomain-like [Domain]
length(61), motif(320:380) 61 IPR001356 Homeobox domain [Domain]
length(63), motif(322:384) 63 IPR001356 Homeobox domain [Domain]
length(57), motif(323:379) 57 IPR001356 Homeobox domain [Domain]
length(24), motif(355:378) 24 IPR017970 Homeobox, conserved site [Conserved_site]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000265606
H-Inv cluster ID Locus viewHIX0201189
Accession number BC075791.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help Representative H-Inv IDRepresentative transcript; 
Coding potential  Help Protein coding; 
Definition Homeobox protein Hox-A13; Homeobox protein Hox-1J;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (P31271)  [Identity/coverage = 99.742%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 25748529020844108399761196809412073020126902051285394821829694ALL
Gene family/group Gene family H-Inv gene family/group ID HIF0000005
Gene family/group name Zinc finger, C2H2-type (IPR007087).
Evidence motif (InterPro) ID 3
Gene symbol/name HGNC symbol NA
HGNC aliases NA
HGNC name NA
DDBJ HOXA13
UniProt HOXA13
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000105531
No. of interaction NA
Interaction partner(s) NA
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:3209
KEGG GENES KEGG GENES(3209)
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Human curated
Notes NA
Related H-InvDB links Zinc finger, C2H2-type (IPR007087). Similarity Search ToolSimilarity Search Tool TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function DNA binding (GO:0003677);  sequence-specific DNA binding (GO:0043565); 
Biological process regulation of transcription, DNA-dependent (GO:0006355); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT nuclear; 
Target P Not predicted
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
311 378 1mnmC 5e-16 26.5 68/77 a.4.1.1
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsA200723; 
Affymetrix
GeneChip
HG-Focus NA
HG-U133 231786_at; 
HG-U133A NA
HG-U133A_2 NA
HG-U133B 231786_at; 
HG-U133_Plus_2 231786_at; 
HG-U95 60937_at; 
HG-U95A NA
HG-U95B NA
HG-U95C 60937_at; 
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 2994174;  3043001;  3043002;  3043003;  3043004;  3043005;  3043006;  3043007;  3043008;  3043009;  3043010;  3043011; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 A_23_P389281; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P31306;  A_23_P389281; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Disease/pathology information  DiseaseInfo Viewer LEGENDA Last modified:27-May-2015
Disease relation Disease name: Guttmacher syndrome (176305);  Disease name: Hand-foot-uterus syndrome (140000); 
Related information in OMIM OMIM ID:  142959;  Title: HOMEOBOX A13
Co-localized orphan diseases NA
Disease related mutation NA
Literature-Extracted GENe-Disease Associations (LEGENDA) LEGENDA Gene name Entrez Gene ID:(3209)
Disease Entrez Gene ID:(3209)
Substance Entrez Gene ID:(3209)
Related H-InvDB links DiseaseInfo ViewerDiseaseInfo ViewerLEGENDALEGENDA

Evolutionary information  Evola Help Last modified:27-May-2015
Relationship Species Accession number MGI Links
Orthology Danio sp. (Zebrafish) BC090761 G-integraG-integra
Orthology Bos sp. (Cow) ENSBTAT00000046051 G-integraG-integra
Orthology Canis sp. (Dog) ENSCAFT00000004756 G-integraG-integra
Orthology Gallus sp. (Chicken) ENSGALT00000037816 G-integraG-integra
Orthology Mus sp. (Mouse) ENSMUST00000047993 G-integraG-integra
Orthology Oryzias sp. (Medaka) ENSORLT00000006356 G-integraG-integra
Orthology Pongo sp. (Orangutan) ENSPPYT00000020620 G-integraG-integra
Orthology Rattus sp. (Rat) ENSRNOT00000010441 G-integraG-integra
Orthology Tetraodon sp. (Tetraodon) GSTENT00020457001 G-integraG-integra
Orthology Takifugu sp. (Fugu) SINFRUT00000179640 G-integraG-integra
Orthology Monodelphis sp. (Opossum) XM_001362439 G-integraG-integra
Orthology Pan sp. (Chimpanzee) XM_527701 G-integraG-integra
Phylogenetic tree [View by ATV]
Neighbor-joining (phb) 
Related H-InvDB links EvolaEvoladN/dS (under constraction); 

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
9 .. 9 C/T rs200152660 - 5'UTR
15 .. 15 C/T rs200700938 - 5'UTR
75 .. 75 G/A rs200676634 - CDS Nonsynonymous[Val16Ile]
176 .. 176 G/A rs35042646 + CDS Synonymous[Ala49Ala]
450 ^ 451 -/AGGCGGGCC rs35599078 + CDS
525 .. 525 C/A rs34398255 + CDS Nonsynonymous[Pro166Thr]
533 .. 533 G/A rs34185333 + CDS Synonymous[Ala168Ala]
626 .. 626 G/T/A rs35255035 - CDS
662 .. 662 G/T rs35277569 + CDS Nonsynonymous[Met211Ile]
670 .. 670 C/A rs150062376 - CDS Nonsynonymous[Ala214Asp]
691 .. 691 T/A rs139336802 - CDS Nonsynonymous[Phe221Tyr]
697 .. 697 C/G rs41311757 - CDS Nonsynonymous[Ser223Cys]
702 .. 702 G/C rs151310409 - CDS Nonsynonymous[Ala225Pro]
713 .. 713 C/T rs201761598 - CDS Synonymous[Phe228Phe]
716 .. 716 C/G rs1065462 + CDS Synonymous[Ala229Ala]
813 .. 813 G/A rs61737504 - CDS Nonsynonymous[Gly262Ser]
846 .. 846 A/G rs139880902 - CDS Nonsynonymous[Met273Val]
888 .. 888 G/A rs145935388 - CDS Nonsynonymous[Gly287Ser]
915 .. 915 G/C rs199871426 - CDS Nonsynonymous[Ala296Pro]
926 .. 926 C/T rs183941484 - CDS Synonymous[Pro299Pro]
944 .. 944 T/G rs200379258 - CDS Synonymous[Thr305Thr]
953 .. 953 C/A rs142315866 - CDS Nonsynonymous[Asp308Glu]
957 .. 957 G/A rs112749872 - CDS Nonsynonymous[Val310Ile]
979 .. 979 G/C rs139120665 - CDS Nonsynonymous[Ser317Thr]
982 .. 982 C/G rs146259736 - CDS Nonsynonymous[Ser318Cys]
991 .. 991 G/A rs76529896 - CDS Nonsynonymous[Arg321Lys]
994 ^ 995 -/G rs11386833 - CDS
1031 .. 1031 A/G rs35608915 + CDS Synonymous[Leu334Leu]
1052 .. 1052 C/T rs138584447 - CDS Synonymous[Tyr341Tyr]
1105 .. 1105 C/T rs149615551 - CDS Nonsynonymous[Thr359Met]
1136 .. 1136 G/A rs104894019 + CDS AA-STOP[Trp369*]
1143 .. 1143 A/C rs121912542 + CDS Nonsynonymous[Asn372His]
1170 ^ 1171 -/G rs66586358 - CDS
1246 .. 1246 C/T rs199530619 - 3'UTR
1247 .. 1247 G/A rs138250182 - 3'UTR
1309 .. 1309 A/C rs41303372 - 3'UTR
1343 .. 1343 A/T rs17472448 - 3'UTR
1504 .. 1504 T/G rs181575995 - 3'UTR
1560 .. 1560 G/A rs2189239 - 3'UTR
1707 .. 1707 A/G rs143288289 - 3'UTR
1972 .. 1972 A/G rs189176903 - 3'UTR
2055 .. 2055 A/G rs757181 - 3'UTR
2143 .. 2143 T/C rs112139316 - 3'UTR
2168 .. 2168 G/A rs145750950 - 3'UTR
2186 ^ 2187 -/C rs35379558 - 3'UTR
2194 .. 2194 T/C rs185640292 - 3'UTR
2294 .. 2294 T/A rs142106798 - 3'UTR
2353 .. 2353 C/A rs181330984 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer