H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000265606 Accession number: BC075791 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Homeobox protein Hox-A13; Homeobox protein Hox-1J;
 
 

Motif information
ORF

length(388),orf(30:1196)
MTASVLLHPRWIEPTVMFLYDNGGGLVADELNKNMEGAAAAAAAAAAAAA
AGAGGGGFPHPAAAAAGGNFSVAAAAAAAAAAAANQCRNLMAHPAPLAPV
AASAYSSAPGEAPPSAAAAAAAAAAAAAAAAAASSSGGPGPAGPAGAEAA
KQCSPCSAAAQSSSGPAALPYGYFGSGYYPCARMGPHPNAIKSCAQPASA
AAAAAFADKYMDTAGPAAEEFSSRAKEFAFYHQGYAAGPYHHHQPMPGYL
DMPVVPGLGGPGESRHEPLGLPMESYQPWALPNGWNGQMYCPKEQAQPPH
LWKSTLPDVVSHPSDASSYRRGRKKRVPYTKVQLKELEREYATNKFITKD
KRRRISATTNLSERQVTIWFQNRRVKEKKVINKLKTTS*
a.a.
length
InterPro Name
length(57), motif(79:135) 57 IPR022067 Homeobox protein Hox1A3 N-terminal [Domain]
length(101), motif(124:224) 101 IPR022067 Homeobox protein Hox1A3 N-terminal [Domain]
length(77), motif(303:379) 77 IPR009057 Homeodomain-like [Domain]
length(69), motif(312:380) 69 IPR009057 Homeodomain-like [Domain]
length(61), motif(320:380) 61 IPR001356 Homeobox domain [Domain]
length(63), motif(322:384) 63 IPR001356 Homeobox domain [Domain]
length(57), motif(323:379) 57 IPR001356 Homeobox domain [Domain]
length(24), motif(355:378) 24 IPR017970 Homeobox, conserved site [Conserved_site]