H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000266043 Accession number: BC083513 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Zinc finger protein 638; Cutaneous T-cell lymphoma-associated antigen se33-1; CTCL-associated antigen se33-1; Nuclear protein 220; Zinc finger matrin-like protein;
 
 

Motif information
ORF

length(1957),orf(283:6156)
MSRPRFNPRGDFPLQRPRAPNPSGMRPPGPFMRPGSMGLPRFYPAGRARG
IPHRFAGHESYQNMGPQRMNVQVTQHRTDPRLTKEKLDFHEAQQKKGKPH
GSRWDDEPHISASVAVKQSSVTQVTEQSPKVQSRYTKESASSILASFGLS
NEDLEELSRYPDEQLTPENMPLILRDIRMRKMGRRLPNLPSQSRNKETLG
SEAVSSNVIDYGHASKYGYTEDPLEVRIYDPEIPTDEVENEFQSQQNISA
SVPNPNVICNSMFPVEDVFRQMDFPGESSNNRSFFSVESGTKMSGLHISG
GQSVLEPIKSVNQSINQTVSQTMSQSLIPPSMNQQPFSSELISSVSQQER
IPHEPVINSSNVHVGSRGSKKNYQSQADIPIRSPFGIVKASWLPKFSHAD
AQKMKRLPTPSMMNDYYAASPRIFPHLCSLCNVECSHLKDWIQHQNTSTH
IESCRQLRQQYPDWNPEILPSRRNEGNRKENETPRRRSHSPSPRRSRRSS
SSHRFRRSRSPMHYMYRPRSRSPRICHRFISRYRSRSRSRSPYRIRNPFR
GSPKCFRSVSPERMSRRSVRSSDRKKALEDVVQRSGHGTEFNKQKHLEAA
DKGHSPAQKPKTSSGTKPSVKPTSATKSDSNLGGHSIRCKSKNLEDDTLS
ECKQVSDKAVSLQRKLRKEQSLHYGSVLLITELPEDGCTEEDVRKLFQPF
GKVNDVLIVPYRKEAYLEMEFKEAITAIMKYIETTPLTIKGKSVKICVPG
KKKAQNKEVKKKTLESKKVSASTLKRDADASKAVEIVTSTSAAKTGQAKA
SVAKVNKSTGKSASSVKSVVTVAVKGNKASIKTAKSGGKKSLEAKKTGNV
KNKDSNKPVTIPENSEIKTSIEVKATENCAKEAISDAALEATENEPLNKE
TEEMCVMLVSNLPNKGYSVEEVYDLAKPFGGLKDILILSSHKKAYIEINR
KAAESMVKFYTCFPVLMDGNQLSISMAPENMNIKDEEAIFITLVKENDPE
...
a.a.
length
InterPro Name
length(25), motif(426:450) 25 IPR015880 Zinc finger, C2H2-like [Domain]
length(92), motif(667:758) 92 IPR012677 Nucleotide-binding alpha-beta plait domain [Domain]
length(71), motif(676:746) 71 IPR000504 RNA recognition motif domain [Domain]
length(71), motif(677:747) 71 IPR000504 RNA recognition motif domain [Domain]
length(86), motif(898:983) 86 IPR012677 Nucleotide-binding alpha-beta plait domain [Domain]
length(84), motif(998:1081) 84 IPR012677 Nucleotide-binding alpha-beta plait domain [Domain]