H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000322075 Accession number: X57206 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Inositol-trisphosphate 3-kinase B; EC=2.7.1.127; Inositol 1,4,5-trisphosphate 3-kinase B; IP3 3-kinase B; IP3K B; InsP 3-kinase B;
 
 

Transcript original information
Accession number X57206.1
CAGE tag ID NA
EST ID NA
Clone Number hh2T
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (ITPKB) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (ITPKB);
Sequence data provider NA
Annotation project NA
Length of cDNA 4505[bp] (No. of exon:7)[A:1001 T:1025 G:1266 C:1213]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type hippocampus
Develpmental stage 2 years old
Mini-G
Sequence quality information
CDS feature N-truncated
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature Truncation; 
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0001645
Genomic location  G-integra Help Chromosome 1
Location 1q42.12
Position 226819393- 226923831
Strand -
Possible duplicated location(s) NA
Gene structure 7 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:3707
KEGG GENES KEGG GENES(3707)
GeneCard GeneCardITPKB*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS;  G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000015412
Predicted CDS 3..1520;  505[aa];  Orientation:+3; 
Codon Adaptation Index (CAI). 0.844

Motif information
ORF

length(505),orf(3:1520)
IPEGGSPTLGLLGGSPSAQPGTGNVEAGIPSGRMLEPLPCWDAAKDLKEP
QCPPGDRVGVQPGNSRVWQGTMEKAGLAWTRGTGVQSEGTWESQRQDSDA
LPSPELLPQDQDKPFLRKACSPSNIPAVIITDMGTQEDGALEETQGSPRG
NLPLRKLSSSSASSTGFSSSYEDSEEDISSDPERTLDPNSAFLHTLDQQK
PRVSKSWRKIKNMVHWSPFVMSFKKKYPWIQLAGHAGSFKAAANGRILKK
HCESEQRCLDRLMVDVLRPFVPAYHGDVVKDGERYNQMDDLLADFDSPCV
MDCKMGIRTYLEEELTKARKKPSLRKDMYQKMIEVDPEAPTEEEKAQRAV
TKPRYMQWRETISSTATLGFRIEGIKKEDGTVNRDFKKTKTREQVTEAFR
EFTKGNHNILIAYRDRLKAIRTTLEVSPFFKCHEVIGSSLLFIHDKKEQA
KVWMIDFGKTTPLPEGQTLQHDVPWQEGNREDGYLSGLNNLVDILTEMSQ
DAPLA*
a.a.
length
InterPro Name
length(502), motif(3:504) 502 IPR005522 Inositol polyphosphate kinase [Family]
length(211), motif(285:495) 211 IPR005522 Inositol polyphosphate kinase [Family]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000322075
H-Inv cluster ID Locus viewHIX0001645
Accession number X57206.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Similar to Inositol-trisphosphate 3-kinase B; EC=2.7.1.127; Inositol 1,4,5-trisphosphate 3-kinase B; IP3 3-kinase B; IP3K B; InsP 3-kinase B;
Similarity category  Help Category: Similar to known protein(Category II).
Similar to known protein (P27987)  [Identity/coverage = 99.801%/53.17%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 1654894118464191548933416710414180880871866964819690332ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol ITPKB
HGNC aliases "inositol 1,4,5-trisphosphate 3-kinase B"
HGNC name inositol-trisphosphate 3-kinase B
DDBJ NA
UniProt ITPKB
EC number EC 2.7.1.127inositol-trisphosphate 3-kinase; 
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway 00562 :Inositol phosphate metabolism;  04020 :Calcium signaling pathway;  04070 :Phosphatidylinositol signaling system; 
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000015412
No. of interaction NA
Interaction partner(s) NA
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:3707
KEGG GENES KEGG GENES(3707)
GeneCard GeneCardITPKB*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function inositol trisphosphate 3-kinase activity (GO:0008440); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT nuclear;  cytosol; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
212 467 1tzdA 5e-94 63.8 243/243 d.143.1.3
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene NA
Affymetrix
GeneChip
HG-Focus 203723_at; 
HG-U133 203723_at; 
HG-U133A 203723_at; 
HG-U133A_2 203723_at; 
HG-U133B NA
HG-U133_Plus_2 203723_at; 
HG-U95 37272_at; 
HG-U95A 37272_at; 
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 2383218;  2383220;  2383224;  2458923;  2458924;  2458925;  2458929;  2458931;  2458935;  2458944;  2458946;  2458947;  2458983;  2458984;  2458985; 
HuGeneFL X57206_at; 
Agilent Human 1A Oligo Microarray:PGID215 A_23_P200461;  A_23_P372255; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P372255; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
26 .. 26 G/T rs145422821 - CDS Synonymous[Thr8Thr]
38 .. 38 T/A rs145686852 - CDS Synonymous[Leu12Leu]
60 .. 60 C/T rs35823273 - CDS Nonsynonymous[Pro20Ser]
90 .. 90 C/G rs200314048 - CDS Nonsynonymous[Pro30Ala]
94 .. 94 C/T rs200706684 - CDS Nonsynonymous[Ser31Phe]
133 .. 133 C/T rs139663092 - CDS Nonsynonymous[Ala44Val]
134 .. 134 G/A rs146213841 - CDS Synonymous[Ala44Ala]
152 .. 152 T/C rs199950711 - CDS Synonymous[Pro50Pro]
160 .. 160 C/G rs201909512 - CDS Nonsynonymous[Pro53Arg]
254 .. 254 G/T rs143869693 - CDS Synonymous[Gly84Gly]
304 .. 304 T/C rs56336740 - CDS Nonsynonymous[Leu101Pro]
313 .. 313 C/T rs149543375 - CDS Nonsynonymous[Pro104Leu]
334 .. 334 A/C rs708776 + CDS Nonsynonymous[Gln111Pro]
356 .. 356 G/A rs56305018 - CDS Synonymous[Lys118Lys]
357 .. 357 G/T rs147065422 - CDS Nonsynonymous[Ala119Ser]
366 .. 366 C/T rs151260470 - CDS Nonsynonymous[Pro122Ser]
373 .. 373 A/G rs149227914 - CDS Nonsynonymous[Asn124Ser]
374 .. 374 C/T rs144456622 - CDS Synonymous[Asn124Asn]
421 .. 421 C/T rs146361736 - CDS Nonsynonymous[Ala140Val]
433 .. 433 C/T rs192959669 - CDS Nonsynonymous[Thr144Met]
443 .. 443 C/T rs56095953 - CDS Synonymous[Ser147Ser]
454 .. 454 A/G rs141636221 - CDS Nonsynonymous[Asn151Ser]
455 .. 455 C/T rs55822534 - CDS Synonymous[Asn151Asn]
496 .. 496 C/T rs143130106 - CDS Nonsynonymous[Thr165Met]
497 .. 497 G/A rs200242451 - CDS Synonymous[Thr165Thr]
515 .. 515 C/T rs147737688 - CDS Synonymous[Tyr171Tyr]
539 .. 539 C/T rs145677527 - CDS Synonymous[Ser179Ser]
552 .. 552 C/T rs34777857 - CDS Nonsynonymous[Arg184Cys]
557 .. 557 C/G rs188607402 - CDS Synonymous[Thr185Thr]
568 .. 568 A/G rs146855114 - CDS Nonsynonymous[Asn189Ser]
575 .. 575 T/C rs708775 + CDS Synonymous[Ala191Ala]
675 .. 675 A/C rs149892910 - CDS Nonsynonymous[Lys225Gln]
783 .. 783 C/T rs201575747 - CDS Nonsynonymous[Arg261Trp]
887 .. 887 C/T rs142941907 - CDS Synonymous[Phe295Phe]
902 .. 902 G/A rs55658830 - CDS Synonymous[Val300Val]
948 .. 948 A/G rs140588026 - CDS Nonsynonymous[Thr316Ala]
957 .. 957 C/T rs200871560 - CDS Nonsynonymous[Arg319Trp]
958 .. 958 G/A rs200031424 - CDS Nonsynonymous[Arg319Gln]
1025 .. 1025 C/A rs201233756 - CDS Synonymous[Thr341Thr]
1139 .. 1139 C/T rs112559528 - CDS Synonymous[Asp379Asp]
1164 .. 1164 A/G rs189824231 - CDS Nonsynonymous[Lys388Glu]
1175 .. 1175 G/A rs116826768 - CDS Synonymous[Thr391Thr]
1190 .. 1190 C/T rs56308606 - CDS Synonymous[Thr396Thr]
1224 .. 1224 A/G rs142841950 - CDS Nonsynonymous[Asn408Asp]
1229 .. 1229 C/T rs199794306 - CDS Synonymous[Ile409Ile]
1232 .. 1232 G/C rs140734599 - CDS Synonymous[Leu410Leu]
1236 .. 1236 G/A rs41314270 - CDS Nonsynonymous[Ala412Thr]
1264 .. 1264 G/A rs142586470 - CDS Nonsynonymous[Arg421Gln]
1278 .. 1278 G/A rs139555467 - CDS Nonsynonymous[Val426Ile]
1301 .. 1301 C/T rs144186587 - CDS Synonymous[His433His]
1307 .. 1307 C/T rs144146349 - CDS Synonymous[Val435Val]
1319 .. 1319 C/G rs56317152 - CDS Synonymous[Ser439Ser]
1367 .. 1367 C/T rs138300662 - CDS Synonymous[Ile455Ile]
1384 .. 1384 C/T rs112742624 - CDS Nonsynonymous[Thr461Met]
1419 .. 1419 G/A rs148881608 - CDS Nonsynonymous[Val473Ile]
1429 .. 1429 A/G rs143399880 - CDS Nonsynonymous[Gln476Arg]
1432 .. 1432 A/T rs200463975 - CDS Nonsynonymous[Glu477Val]
1433 .. 1433 G/A rs145379834 - CDS Synonymous[Glu477Glu]
1489 .. 1489 C/A rs141265042 - CDS Nonsynonymous[Thr496Asn]
1501 .. 1501 A/G rs144277668 - CDS Nonsynonymous[Gln500Arg]
1512 .. 1512 C/G rs41268733 - CDS Nonsynonymous[Leu504Val]
1514 .. 1514 C/A rs186433398 - CDS Synonymous[Leu504Leu]
1515 .. 1515 G/A rs202144792 - CDS Nonsynonymous[Ala505Thr]
1638 .. 1638 A/G rs149753354 - 3'UTR
1662 .. 1662 A/G rs181903007 - 3'UTR
1769 .. 1769 G/C rs191801345 - 3'UTR
1782 .. 1782 C/T rs187219364 - 3'UTR
1833 .. 1833 C/G rs74139714 - 3'UTR
1941 .. 1941 C/T rs56907962 - 3'UTR
1972 .. 1972 C/T rs41268731 - 3'UTR
2035 .. 2035 G/A rs139459912 - 3'UTR
2071 .. 2071 C/T rs147572644 - 3'UTR
2162 .. 2162 A/G rs181733648 - 3'UTR
2295 .. 2295 C/T rs188236799 - 3'UTR
2445 .. 2445 G/A rs113971723 - 3'UTR
2480 .. 2480 G/A rs139507461 - 3'UTR
2495 .. 2495 G/A rs147384105 - 3'UTR
2537 .. 2537 G/A rs58216094 - 3'UTR
2586 .. 2586 T/C rs1144838 - 3'UTR
2646 .. 2646 G/C rs183504225 - 3'UTR
2679 .. 2679 C/A rs3820634 - 3'UTR
2753 .. 2753 A/T rs3738723 - 3'UTR
2813 .. 2813 C/G rs115633474 - 3'UTR
2842 .. 2842 C/T rs180783120 - 3'UTR
2871 .. 2871 A/G rs113734412 - 3'UTR
2913 .. 2913 G/C rs148568530 - 3'UTR
2914 .. 2914 G/A rs189700932 - 3'UTR
2930 .. 2930 G/A rs144827491 - 3'UTR
2955 .. 2955 G/A rs3738722 - 3'UTR
2978 .. 2978 C/T rs149442069 - 3'UTR
3083 .. 3083 A/G rs12120964 - 3'UTR
3170 .. 3170 G/A rs3820633 - 3'UTR
3183 .. 3183 C/T rs184862451 - 3'UTR
3257 .. 3257 G/A rs192977879 - 3'UTR
3287 .. 3287 A/G rs17587821 - 3'UTR
3392 .. 3392 C/T rs1050492 + 3'UTR
3640 .. 3640 G/C rs1144839 - 3'UTR
3663 ^ 3664 -/T rs199620845 - 3'UTR
3673 .. 3673 T/C rs199598117 - 3'UTR
3674 ^ 3675 -/T rs113989266 - 3'UTR
3694 .. 3694 T/C rs11577521 - 3'UTR
3739 .. 3739 C/T rs185560367 - 3'UTR
3951 .. 3951 C/G rs192414053 - 3'UTR
3981 .. 3981 G/A rs144939462 - 3'UTR
4059 .. 4059 T/C rs1144840 - 3'UTR
4096 .. 4096 T/C rs76708073 - 3'UTR
4101 .. 4101 T/C rs142787631 - 3'UTR
4120 ^ 4121 -/T rs35705316 - 3'UTR
4127 .. 4127 C/T rs138286830 - 3'UTR
4132 .. 4132 G/T rs45532233 - 3'UTR
4259 .. 4259 G/A rs115660647 - 3'UTR
4331 .. 4331 G/A rs150439183 - 3'UTR
4360 .. 4360 C/-/CC rs3832012 - 3'UTR
4436 .. 4436 T/C rs111864741 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
Type Start End Strand
MamRep434 3331 3654 +
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer