H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000322075 Accession number: X57206 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Inositol-trisphosphate 3-kinase B; EC=2.7.1.127; Inositol 1,4,5-trisphosphate 3-kinase B; IP3 3-kinase B; IP3K B; InsP 3-kinase B;
 
 

Motif information
ORF

length(505),orf(3:1520)
IPEGGSPTLGLLGGSPSAQPGTGNVEAGIPSGRMLEPLPCWDAAKDLKEP
QCPPGDRVGVQPGNSRVWQGTMEKAGLAWTRGTGVQSEGTWESQRQDSDA
LPSPELLPQDQDKPFLRKACSPSNIPAVIITDMGTQEDGALEETQGSPRG
NLPLRKLSSSSASSTGFSSSYEDSEEDISSDPERTLDPNSAFLHTLDQQK
PRVSKSWRKIKNMVHWSPFVMSFKKKYPWIQLAGHAGSFKAAANGRILKK
HCESEQRCLDRLMVDVLRPFVPAYHGDVVKDGERYNQMDDLLADFDSPCV
MDCKMGIRTYLEEELTKARKKPSLRKDMYQKMIEVDPEAPTEEEKAQRAV
TKPRYMQWRETISSTATLGFRIEGIKKEDGTVNRDFKKTKTREQVTEAFR
EFTKGNHNILIAYRDRLKAIRTTLEVSPFFKCHEVIGSSLLFIHDKKEQA
KVWMIDFGKTTPLPEGQTLQHDVPWQEGNREDGYLSGLNNLVDILTEMSQ
DAPLA*
a.a.
length
InterPro Name
length(502), motif(3:504) 502 IPR005522 Inositol polyphosphate kinase [Family]
length(211), motif(285:495) 211 IPR005522 Inositol polyphosphate kinase [Family]