H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000330976 Accession number: AK223196 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: 26S proteasome non-ATPase regulatory subunit 11; 26S proteasome regulatory subunit RPN6; 26S proteasome regulatory subunit S9; 26S proteasome regulatory subunit p44.5;
 
 

Transcript original information
Accession number AK223196.1
CAGE tag ID NA
EST ID NA
Clone Number PNC08823
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (PSMD11) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (PSMD11);
Sequence data provider NA
Annotation project NA
Length of cDNA 1520[bp] (No. of exon:14)[A:436 T:363 G:386 C:335]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type pancreas
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 1497(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0013704
Genomic location  G-integra Help Chromosome 17
Location 17q11.2
Position 30771528- 30807981
Strand +
Possible duplicated location(s) NA
Gene structure 14 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:5717
KEGG GENES KEGG GENES(5717)
GeneCard GeneCardPSMD11*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000145914
Predicted CDS 15..1286;  423[aa];  Orientation:+3; 
Codon Adaptation Index (CAI). 0.738

Motif information
ORF

length(423),orf(15:1286)
MAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSI
LELGSLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDME
AATGQEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALHLG
SQLLRELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAI
YCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPKAITS
LKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLA
DFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHI
SSLIKLSKADVERKLSQMILDKKFHAGILDQGEGVLIIFDEPPVDKTYEA
ALETIQNMSKVVDSLYNKAKKLT*
a.a.
length
InterPro Name
length(112), motif(128:239) 112 IPR011990 Tetratricopeptide-like helical domain [Domain]
length(178), motif(143:320) 178 IPR013143 PCI/PINT associated module [Domain]
length(100), motif(289:388) 100 IPR000717 Proteasome component (PCI) domain [Domain]
length(83), motif(316:398) 83 IPR011991 Winged helix-turn-helix DNA-binding domain [Domain]
length(85), motif(321:405) 85 IPR000717 Proteasome component (PCI) domain [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000330976
H-Inv cluster ID Locus viewHIX0013704
Accession number AK223196.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition 26S proteasome non-ATPase regulatory subunit 11; 26S proteasome regulatory subunit RPN6; 26S proteasome regulatory subunit S9; 26S proteasome regulatory subunit p44.5;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (O00231)  [Identity/coverage = 99.764%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 911906094262561266580114702039154893341732392418669648196161152126946022972301ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol PSMD11
HGNC aliases NA
HGNC name proteasome (prosome, macropain) 26S subunit, non-ATPase, 11
DDBJ NA
UniProt PSMD11
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000145914
No. of interaction 54
Interaction partner(s) HIP000001508HIP000007787HIP000021834HIP000024064HIP000031014HIP000031014HIP000031138HIP000036574HIP000036910HIP000036910HIP000037230HIP000037925HIP000039048HIP000039564HIP000039637HIP000040785HIP000040785HIP000041731HIP000043069HIP000043386HIP000044271HIP000059222HIP000060676HIP000060745HIP000061587HIP000066993HIP000070521HIP000074284HIP000075304HIP000079988HIP000080383HIP000084431HIP000084431HIP000089774HIP000091245HIP000092088HIP000094776HIP000097703HIP000100441HIP000101460HIP000102459HIP000106185HIP000108285HIP000108285HIP000111683HIP000112589HIP000113269HIP000113269HIP000139489HIP000144654HIP000144654HIP000147861HIP000164030HIP000183325
BIND 149953;  150092;  150230;  150378;  150430; 
DIP 112238E;  112623E;  113404E;  116339E;  116994E;  177176E;  177210E;  177435E; 
MINT MINT-3373344;  MINT-48607;  MINT-49599;  MINT-61588;  MINT-61715;  MINT-61831;  MINT-61959;  MINT-62003;  MINT-63021;  MINT-63022;  MINT-63023;  MINT-63024;  MINT-63025;  MINT-63027;  MINT-63028;  MINT-63029;  MINT-63030;  MINT-63032;  MINT-63033;  MINT-63034;  MINT-63035;  MINT-63036;  MINT-63037;  MINT-63039;  MINT-63040;  MINT-63041;  MINT-63042;  MINT-63043;  MINT-7230300;  MINT-7945693;  MINT-7947479; 
HPRD 00559;  00590;  00713;  01147;  01199;  01239;  01852;  01859;  02557;  02972;  02995;  03356;  03400;  03560;  03833;  03913;  03968;  04043;  04045;  04184;  04340;  04381;  04595;  04927;  06208;  06828;  07505;  07761;  10293;  10379;  10603;  11309;  11745;  11762;  12531;  13173;  14378;  14382;  16735;  17975;  18370; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:5717
KEGG GENES KEGG GENES(5717)
GeneCard GeneCardPSMD11*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function protein binding (GO:0005515); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT cytosol;  nuclear; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
326 398 1ufmA 5e-14 22.2 72/100 a.4.5.47
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsA150407; 
Affymetrix
GeneChip
HG-Focus 208777_s_at; 
HG-U133 208777_s_at; 
HG-U133A 208777_s_at; 
HG-U133A_2 208777_s_at; 
HG-U133B NA
HG-U133_Plus_2 208777_s_at; 
HG-U95 1191_s_at;  52399_at; 
HG-U95A 1191_s_at; 
HG-U95B 52399_at; 
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 3717745;  3717749;  3717750;  3717751;  3717752;  3717753;  3717755;  3717758;  3717761;  3717763;  3717765;  3717767;  3717769;  3752691;  3752701;  3752703; 
HuGeneFL AB003102_at; 
Agilent Human 1A Oligo Microarray:PGID215 NA
Whole Human Genome Oligo Microarray:PGID247 NA
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
29 .. 29 G/T rs143871497 + CDS Synonymous[Ala5Ala]
59 .. 59 A/T rs201788002 + CDS Synonymous[Leu15Leu]
64 .. 64 G/A rs140202481 + CDS Nonsynonymous[Ser17Asn]
73 .. 73 G/A rs201397972 + CDS Nonsynonymous[Arg20Gln]
335 .. 335 C/G rs143910284 + CDS Synonymous[Val107Val]
350 .. 350 G/A rs146863808 + CDS Synonymous[Glu112Glu]
356 .. 356 C/T rs140675261 + CDS Synonymous[Ile114Ile]
433 .. 433 C/A rs142904428 + CDS Nonsynonymous[Thr140Asn]
477 .. 477 C/G rs200794922 + CDS Nonsynonymous[Arg155Gly]
539 .. 539 A/G rs151071670 + CDS Synonymous[Lys175Lys]
617 .. 617 C/T rs192755593 + CDS Synonymous[Tyr201Tyr]
620 .. 620 C/T/G rs34078182 - CDS
656 .. 656 G/A rs150206106 + CDS Synonymous[Ser214Ser]
698 .. 698 G/A rs35385209 - CDS Synonymous[Ala228Ala]
740 .. 740 C/T rs141504283 + CDS Synonymous[Ile242Ile]
797 .. 797 C/T rs146169141 + CDS Synonymous[Leu261Leu]
803 .. 803 C/T rs138901273 + CDS Synonymous[Thr263Thr]
847 .. 847 G/A rs199698435 + CDS Nonsynonymous[Arg278Gln]
899 .. 899 G/A rs34248115 - CDS Synonymous[Lys295Lys]
941 .. 941 C/T rs143543056 + CDS Synonymous[Tyr309Tyr]
954 .. 954 C/T rs148020019 + CDS Nonsynonymous[Arg314Trp]
980 .. 980 C/T rs1803016 + CDS Synonymous[His322His]
1005 .. 1005 C/T rs141677337 + CDS Synonymous[Leu331Leu]
1022 .. 1022 C/A rs201382857 + CDS Synonymous[Ile336Ile]
1024 .. 1024 G/A rs201116985 + CDS Nonsynonymous[Arg337Gln]
1033 .. 1033 A/G rs1803015 + CDS Nonsynonymous[Glu340Gly]
1094 .. 1094 C/T rs200240721 + CDS Synonymous[Asp360Asp]
1121 .. 1121 T/C rs150525156 + CDS Synonymous[Ile369Ile]
1181 .. 1181 C/T rs35729014 - CDS Synonymous[Phe389Phe]
1265 .. 1265 C/A rs78876518 + CDS Nonsynonymous[Asn417Lys]
1286 .. 1286 G/A rs139814136 + CDS Synonymous_atSTOP[*424*]
1323 .. 1323 G/A rs11539943 - 3'UTR
1370 .. 1370 C/T rs1801562 + 3'UTR
1376 .. 1376 G/T rs11539944 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene;  Repeat mask viewerRepeat Mask Viewer