H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000330976 Accession number: AK223196 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: 26S proteasome non-ATPase regulatory subunit 11; 26S proteasome regulatory subunit RPN6; 26S proteasome regulatory subunit S9; 26S proteasome regulatory subunit p44.5;
 
 

Motif information
ORF

length(423),orf(15:1286)
MAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSI
LELGSLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDME
AATGQEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALHLG
SQLLRELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAI
YCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPKAITS
LKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLA
DFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHI
SSLIKLSKADVERKLSQMILDKKFHAGILDQGEGVLIIFDEPPVDKTYEA
ALETIQNMSKVVDSLYNKAKKLT*
a.a.
length
InterPro Name
length(112), motif(128:239) 112 IPR011990 Tetratricopeptide-like helical domain [Domain]
length(178), motif(143:320) 178 IPR013143 PCI/PINT associated module [Domain]
length(100), motif(289:388) 100 IPR000717 Proteasome component (PCI) domain [Domain]
length(83), motif(316:398) 83 IPR011991 Winged helix-turn-helix DNA-binding domain [Domain]
length(85), motif(321:405) 85 IPR000717 Proteasome component (PCI) domain [Domain]