H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000332184 Accession number: AY702938 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to TRNA dimethylallyltransferase, mitochondrial precursor.
 
 

Transcript original information
Accession number AY702938.1
CAGE tag ID NA
EST ID NA
Clone Number NA
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (TRIT1) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (TRIT1);
Sequence data provider NA
Annotation project NA
Length of cDNA 1227[bp] (No. of exon:10)[A:362 T:293 G:297 C:275]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type lung
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) TAGGAG; 
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0000464
Genomic location  G-integra Help Chromosome 1
Location 1p34.2
Position 40307386- 40349106
Strand -
Possible duplicated location(s) NA
Gene structure 10 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:54802
KEGG GENES KEGG GENES(54802)
GeneCard GeneCardTRIT1*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000145243
Predicted CDS 940..1197;  85[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.764

Motif information
ORF

length(85),orf(940:1197)
MPYNEAENKRSYHLCDLCDRIIIGDREWAAHIKSKSHLNQLKKRRRLDSD
AVNTIESQSVSPDHNKEPKEKGSPGQNDQELKCSV*
a.a.
length
InterPro Name
length(23), motif(15:37) 23 IPR022755 Zinc finger, double-stranded RNA binding [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000332184
H-Inv cluster ID Locus viewHIX0000464
Accession number AY702938.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO;  Splicing isoformSplicing isoform
Coding potential  Help Protein coding; 
Definition Similar to TRNA dimethylallyltransferase, mitochondrial precursor.
Similarity category  Help Category: Similar to known protein(Category II).
Similar to known protein (NP_060116)  [Identity/coverage = 100.0%/92.08%] to Homo sapiens protein.
Experimental evidence Protein evidence
PubMed ID NA
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol TRIT1
HGNC aliases NA
HGNC name tRNA isopentenyltransferase 1
DDBJ TRIT1
UniProt NA
EC number EC 2.5.1.75tRNA dimethylallyltransferase; 
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000145243
No. of interaction NA
Interaction partner(s) NA
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:54802
KEGG GENES KEGG GENES(54802)
GeneCard GeneCardTRIT1*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA


Subcellular localization information  Last modified:27-May-2015
WoLF PSORT nuclear;  cytosol; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Twilight zone
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsA241102;  AGhsB230212; 
Affymetrix
GeneChip
HG-Focus NA
HG-U133 210699_at; 
HG-U133A 210699_at; 
HG-U133A_2 210699_at; 
HG-U133B NA
HG-U133_Plus_2 210699_at; 
HG-U95 NA
HG-U95A NA
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 2408118;  2408122;  2408123;  2408126;  2408127;  2408129;  2408130;  2408133;  2408135;  2408136;  2408141; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 NA
Whole Human Genome Oligo Microarray:PGID247 NA
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
8 .. 8 C/A rs192151286 - 5'UTR
88 .. 88 G/A rs143304108 - 5'UTR
133 .. 133 G/A rs57584582 - 5'UTR
139 .. 139 A/G rs200242089 - 5'UTR
179 .. 179 G/C rs35273801 + 5'UTR
190 .. 190 A/C rs144463028 - 5'UTR
192 .. 192 C/G rs199602634 - 5'UTR
245 .. 245 G/A rs201122535 - 5'UTR
269 .. 269 T/C rs146838322 - 5'UTR
307 .. 307 A/G rs139911950 - 5'UTR
403 .. 403 T/A rs3738671 + 5'UTR
411 .. 411 G/T rs57069259 - 5'UTR
420 .. 420 C/T rs34889376 + 5'UTR
430 .. 430 T/C rs151023841 - 5'UTR
433 .. 433 T/G rs140549053 - 5'UTR
452 .. 452 C/T rs58614497 - 5'UTR
457 .. 457 G/A rs143950082 - 5'UTR
512 .. 512 C/T rs140406438 - 5'UTR
513 .. 513 G/A rs145359484 - 5'UTR
581 .. 581 C/T rs201156716 - 5'UTR
603 .. 603 C/T rs149680997 - 5'UTR
640 .. 640 A/G rs145009373 - 5'UTR
641 .. 641 T/C rs199622789 - 5'UTR
660 .. 660 C/T rs139483552 - 5'UTR
752 .. 752 G/A rs141381625 - 5'UTR
772 .. 772 C/T rs144042123 - 5'UTR
773 .. 773 G/A rs201998234 - 5'UTR
788 .. 788 G/A rs79374109 - 5'UTR
789 .. 789 T/G rs138333577 - 5'UTR
852 .. 852 G/C rs200850534 - 5'UTR
874 .. 874 G/T rs78673047 - 5'UTR
891 .. 891 C/T rs16826617 - 5'UTR
923 ^ 924 -/CCCCC rs148029376 - 5'UTR
943 .. 943 C/T rs199509767 - CDS Nonsynonymous[Pro2Ser]
957 .. 957 T/C rs141101045 - CDS Synonymous[Ala6Ala]
1017 .. 1017 C/T rs142932194 - CDS Synonymous[Arg26Arg]
1028 .. 1028 C/T rs147582410 - CDS Nonsynonymous[Ala30Val]
1029 .. 1029 G/A rs201731718 - CDS Synonymous[Ala30Ala]
1191 .. 1191 C/T rs199579505 - CDS Synonymous[Ser84Ser]
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer