H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000332184 Accession number: AY702938 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to TRNA dimethylallyltransferase, mitochondrial precursor.
 
 

Motif information
ORF

length(85),orf(940:1197)
MPYNEAENKRSYHLCDLCDRIIIGDREWAAHIKSKSHLNQLKKRRRLDSD
AVNTIESQSVSPDHNKEPKEKGSPGQNDQELKCSV*
a.a.
length
InterPro Name
length(23), motif(15:37) 23 IPR022755 Zinc finger, double-stranded RNA binding [Domain]