H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000335240 Accession number: BC095447 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Histone H3.3;
 
 

Transcript original information
Accession number BC095447.1
CAGE tag ID NA
EST ID NA
Clone Number MGC:111189 IMAGE:30718542
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (H3F3A) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (H3F3A);
Sequence data provider NA
Annotation project NA
Length of cDNA 963[bp] (No. of exon:4)[A:363 T:214 G:197 C:189]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Spinal cord
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 836(+) Signal: 812-816(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) CAGGAG; 
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0001642
Genomic location  G-integra Help Chromosome 1
Location 1q42.12
Position 226250426- 226259494
Strand +
Possible duplicated location(s) NA
Gene structure 4 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:3020
KEGG GENES KEGG GENES(3020)
GeneCard GeneCardH3F3A*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000033192
Predicted CDS 111..521;  136[aa];  Orientation:+3; 
Codon Adaptation Index (CAI). 0.714
Database links RefSeq NP_002098NP_005315
UniProt P84243P84244P84245P84246P84247P84248P84249P84250Q5E9F8Q6P823Q6PI20Q6PI79Q71LE2
CCDS CCDS11729CCDS1550

Motif information
ORF

length(136),orf(111:521)
MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALR
EIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAY
LVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA*
a.a.
length
InterPro Name
length(136), motif(1:136) 136 IPR000164 Histone H3/CENP-A [Family]
length(132), motif(2:133) 132 IPR009072 Histone-fold [Domain]
length(133), motif(2:134) 133 IPR009072 Histone-fold [Domain]
length(15), motif(3:17) 15 IPR000164 Histone H3/CENP-A [Family]
length(7), motif(15:21) 7 IPR000164 Histone H3/CENP-A [Family]
length(15), motif(17:31) 15 IPR000164 Histone H3/CENP-A [Family]
length(103), motif(34:136) 103 IPR000164 Histone H3/CENP-A [Family]
length(22), motif(34:55) 22 IPR000164 Histone H3/CENP-A [Family]
length(75), motif(58:132) 75 IPR007125 Histone core [Domain]
length(18), motif(58:75) 18 IPR000164 Histone H3/CENP-A [Family]
length(9), motif(67:75) 9 IPR000164 Histone H3/CENP-A [Family]
length(19), motif(80:98) 19 IPR000164 Histone H3/CENP-A [Family]
length(17), motif(98:114) 17 IPR000164 Histone H3/CENP-A [Family]
length(22), motif(114:135) 22 IPR000164 Histone H3/CENP-A [Family]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000335240
H-Inv cluster ID Locus viewHIX0001642
Accession number BC095447.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Histone H3.3;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (P84243)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 28595933031613730971685864261046428611242053118563691256048314718166153457771547187115489334154988741552593915681610156844251577602115851689161850881625849916267050164575881649773216710414171892641719470817898714179740051806605218077460180791821960886119690332197839802022879020850016219253222238702622483618ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol H3F3A
HGNC aliases NA
HGNC name H3 histone, family 3A
DDBJ H3F3A
UniProt H3F3B
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000033192
No. of interaction 1
Interaction partner(s) HIP000093951
BIND 199712;  199713;  199985;  199986;  199987;  295238; 
DIP 103287E;  103288E;  103289E;  103290E;  104118E;  177019E;  177020E; 
MINT MINT-7297026;  MINT-7297041;  MINT-7297055;  MINT-7297083;  MINT-7297101;  MINT-7297122;  MINT-7297142;  MINT-7297159;  MINT-7297192;  MINT-7297230;  MINT-7903394;  MINT-7903429;  MINT-7903444;  MINT-7903461;  MINT-7903490;  MINT-7903511;  MINT-7903524;  MINT-7903554;  MINT-7903569;  MINT-7903594;  MINT-7903607;  MINT-8088939;  MINT-8089021;  MINT-8089040;  MINT-8089088; 
HPRD 00146;  01224;  01818;  02055;  02534;  02559;  02583;  03025;  03245;  03490;  03668;  04078;  04206;  04357;  04424;  04459;  04538;  05021;  05131;  06780;  09417;  10144;  11807;  11876;  12234;  13006;  15100;  16088;  16459;  16460; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:3020
KEGG GENES KEGG GENES(3020)
GeneCard GeneCardH3F3A*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
FR ID FR396827
Accession
Description
Location
PMID

Gene ontology information
Molecular function DNA binding (GO:0003677);  protein heterodimerization activity (GO:0046982); 
Cellular component nucleosome (GO:0000786); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT nuclear; 
Target P Not predicted
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
39 136 1aoiA 4e-24 95.9 98/98 a.22.1.1
Related H-InvDB links GTOP GTOP

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
33 .. 33 C/T rs187973612 + 5'UTR
84 .. 84 G/C rs147478485 + 5'UTR
91 .. 91 A/G rs190693611 + 5'UTR
105 .. 105 T/G rs199699563 + 5'UTR
188 .. 188 T/C rs200633260 + CDS Synonymous[Ala26Ala]
254 .. 254 G/A rs143861201 + CDS Synonymous[Ala48Ala]
455 .. 455 C/T rs201081886 + CDS Synonymous[Ala115Ala]
571 .. 571 A/T rs1057497 + 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer