H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000335274 Accession number: BC095481 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Protein enabled homolog;
 
 

Motif information
ORF

length(591),orf(453:2228)
MSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVG
RKIQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVF
ASAMMHALEVLNSQETGPTLPRQNSQLPAQVQNGPSQEELEIQRRQLQEQ
QRQKELERERLERERMERERLERERLERERLERERLEQEQLERERQERER
QERLERQERLERQERLERQERLDRERQERQERERLERLERERQERERQEQ
LEREQLEWERERRISSAAAPASVETPLNSVLGDSSASEPGLQAASQPAET
PSQQGIVLGPLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPP
PPPPPLPNQVPPPPPPPPAPPLPASGFFLASMSEDNRPLTGLAAAIAGAK
LRKVSRMEDTSFPSGGNAIGVNSASSKTDTGRGNGPLPLGGSGLMEEMSA
LLARRRRIAEKGSTIETEQKEDKGEDSEPVTSKASSTSTPEPIRKPWERT
NTMNGSKSPVISRRDSPRKNQIVFDNRSYDSLHRPKSTPLSQPSANGVQT
EGLDYDRLKQDILDEMRKELTKLKEELIDAIRQELSKSNTA*
a.a.
length
InterPro Name
length(118), motif(1:118) 118 IPR011993 Pleckstrin homology-like domain [Domain]
length(111), motif(1:111) 111 IPR000697 WH1/EVH1 domain [Domain]
length(108), motif(1:108) 108 IPR000697 WH1/EVH1 domain [Domain]
length(107), motif(1:107) 107 IPR000156 Ran binding domain [Domain]
length(104), motif(4:107) 104 IPR000697 WH1/EVH1 domain [Domain]
length(40), motif(551:590) 40 IPR014885 VASP tetramerisation [Domain]