H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000338997 Accession number: BC108255 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: TFIIH basal transcription factor complex helicase XPD subunit; EC=3.6.4.12; Basic transcription factor 2 80 kDa subunit; BTF2 p80; CXPD; DNA excision repair protein ERCC-2; DNA repair protein complementing XP-D cells; TFIIH basal transcription factor complex 80 kDa subunit; TFIIH 80 kDa subunit; TFIIH p80; Xeroderma pigmentosum group D-complementing protein;
 
 

Motif information
ORF

length(760),orf(11:2293)
MKLNVDGLLVYFPYDYIYPEQFSYMRELKRTLDAKGHGVLEMPSGTGKTV
SLLALIMAYQRAYPLEVTKLIYCSRTVPEIEKVIEELRKLLNFYEKQEGE
KLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTASYVRAQYQHDT
SLPHCRFYEEFDAHGREVPLPAGIYNLDDLKALGRRQGWCPYFLARYSIL
HANVVVYSYHYLLDPKIADLVSKELARKAVVVFDEAHNIDNVCIDSMSVN
LTRRTLDRCQGNLETLQKTVLRIKETDEQRLRDEYRRLVEGLREASAARE
TDAHLANPVLPDEVLQEAVPGSIRTAEHFLGFLRRLLEYVKWRLRVQHVV
QESPPAFLSGLAQRVCIQRKPLRFCAERLRSLLHTLEITDLADFSPLTLL
ANFATLVSTYAKGFTIIIEPFDDRTPTIANPILHFSCMDASLAIKPVFER
FQSVIITSGTLSPLDIYPKILDFHPVTMATFTMTLARVCLCPMIIGRGND
QVAISSKFETREDIAVIRNYGNLLLEMSAVVPDGIVAFFTSYQYMESTVA
SWYEQGILENIQRNKLLFIETQDGAETSVALEKYQEACENGRGAILLSVA
RGKVSEGIDFVHHYGRAVIMFGVPYVYTQSRILKARLEYLRDQFQIREND
FLTFDAMRHAAQCVGRAIRGKTDYGLMVFADKRFARGDKRGKLPRWIQEH
LTDANLNLTVDEGVQVAKYFLRQMAQPFHREDQLGLSLLSLEQLESEETL
KRIEQIAQQL*
a.a.
length
InterPro Name
length(277), motif(7:283) 277 IPR014013 Helicase, superfamily 1/2, ATP-binding domain, DinG/Rad3-type [Domain]
length(701), motif(8:708) 701 IPR013020 DNA helicase (DNA repair), Rad3 type [Family]
length(273), motif(8:280) 273 IPR006554 Helicase-like, DEXD box c2 type [Domain]
length(18), motif(8:25) 18 IPR001945 Xeroderma pigmentosum group D protein [Family]
length(95), motif(12:106) 95 IPR027417 P-loop containing nucleoside triphosphate hydrolase [Domain]
length(57), motif(32:88) 57 IPR027417 P-loop containing nucleoside triphosphate hydrolase [Domain]
length(185), motif(72:256) 185 IPR010614 DEAD2 [Domain]
length(63), motif(178:240) 63 IPR027417 P-loop containing nucleoside triphosphate hydrolase [Domain]
length(73), motif(184:256) 73 IPR027417 P-loop containing nucleoside triphosphate hydrolase [Domain]
length(10), motif(229:238) 10 IPR002464 DNA/RNA helicase, ATP-dependent, DEAH-box type, conserved site [Conserved_site]
length(145), motif(269:413) 145 IPR010643 Domain of unknown function DUF1227 [Domain]
length(20), motif(273:292) 20 IPR001945 Xeroderma pigmentosum group D protein [Family]
length(19), motif(308:326) 19 IPR001945 Xeroderma pigmentosum group D protein [Family]
length(22), motif(333:354) 22 IPR001945 Xeroderma pigmentosum group D protein [Family]
length(23), motif(372:394) 23 IPR001945 Xeroderma pigmentosum group D protein [Family]
length(19), motif(403:421) 19 IPR001945 Xeroderma pigmentosum group D protein [Family]
length(15), motif(450:464) 15 IPR027417 P-loop containing nucleoside triphosphate hydrolase [Domain]
length(18), motif(492:509) 18 IPR001945 Xeroderma pigmentosum group D protein [Family]
length(176), motif(524:699) 176 IPR006555 ATP-dependent helicase, C-terminal [Domain]
length(150), motif(529:678) 150 IPR027417 P-loop containing nucleoside triphosphate hydrolase [Domain]
length(145), motif(542:686) 145 IPR006555 ATP-dependent helicase, C-terminal [Domain]
length(23), motif(636:658) 23 IPR001945 Xeroderma pigmentosum group D protein [Family]
length(21), motif(707:727) 21 IPR001945 Xeroderma pigmentosum group D protein [Family]