H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000384281 Accession number: AK225151 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Protein FAM136A;
 
 

Transcript original information
Accession number AK225151.1
CAGE tag ID NA
EST ID NA
Clone Number CBL07744
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (FAM136A) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (FAM136A);
Sequence data provider NA
Annotation project NA
Length of cDNA 1663[bp] (No. of exon:3)[A:470 T:421 G:437 C:335]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type cerebellum
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0002139
Genomic location  G-integra Help Chromosome 2
Location 2p13.3
Position 70523220- 70529188
Strand -
Possible duplicated location(s) NA
Gene structure 3 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:84908
KEGG GENES KEGG GENES(84908)
GeneCard GeneCardFAM136A*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000025941
Predicted CDS 46..462;  138[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.85
Database links RefSeq NP_116211
UniProt Q96C01
CCDS CCDS1904

Motif information
ORF

length(138),orf(46:462)
MAELQQLRVQEAVESMVKSLERENIRKMQGLMFRCSASCCEDSQASMKQV
HQCIERCHVPLAQAQALVTSELEKFQDRLARCTMHCNDKAKDSIDAGSKE
LQVKQQLDSCVTKCVDDHMHLIPTMTKKMKEALLSIGK*
a.a.
length
InterPro Name
length(138), motif(1:138) 138 IPR008560 Protein of unknown function DUF842, eukaryotic [Family]
length(129), motif(5:133) 129 IPR008560 Protein of unknown function DUF842, eukaryotic [Family]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000384281
H-Inv cluster ID Locus viewHIX0002139
Accession number AK225151.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help Representative H-Inv IDRepresentative transcript;  Splicing isoformSplicing isoform
Coding potential  Help Protein coding; 
Definition Protein FAM136A;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (Q96C01)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 14702039154893341581562121269460ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol FAM136A
HGNC aliases NA
HGNC name family with sequence similarity 136, member A
DDBJ NA
UniProt FAM136A
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000025941
No. of interaction 21
Interaction partner(s) HIP000026676HIP000035962HIP000039295HIP000058896HIP000064854HIP000069680HIP000074321HIP000075289HIP000075675HIP000091609HIP000097392HIP000100433HIP000100543HIP000103454HIP000111577HIP000136548HIP000145725HIP000153420HIP000249412HIP000435860HIP000435860
BIND 133840; 
DIP NA
MINT NA
HPRD 06281; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:84908
KEGG GENES KEGG GENES(84908)
GeneCard GeneCardFAM136A*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Human curated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA


Subcellular localization information  Last modified:27-May-2015
WoLF PSORT extracellular;  cytosol;  nuclear;  Other; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
17 .. 17 G/C rs201016906 - 5'UTR
44 .. 44 C/T rs201738687 - 5'UTR
102 .. 102 T/C rs140039326 - CDS Synonymous[Ser19Ser]
117 .. 117 C/T rs11540071 + CDS Synonymous[Asn24Asn]
142 .. 142 T/C rs144063803 - CDS Nonsynonymous[Phe33Leu]
153 .. 153 C/T rs72904358 - CDS Synonymous[Ser36Ser]
182 .. 182 C/T rs148232572 - CDS Nonsynonymous[Ser46Phe]
188 .. 188 A/G rs149094970 - CDS Nonsynonymous[Lys48Arg]
212 .. 212 G/A rs145586904 - CDS Nonsynonymous[Arg56His]
236 .. 236 C/T rs146550319 - CDS Nonsynonymous[Ala64Val]
240 .. 240 G/C rs144178982 - CDS Nonsynonymous[Gln65His]
247 .. 247 G/T rs142320110 - CDS Nonsynonymous[Val68Phe]
277 .. 277 C/T rs79696069 - CDS Nonsynonymous[Arg78Cys]
283 .. 283 G/T rs199565792 - CDS Nonsynonymous[Ala80Ser]
296 .. 296 T/C rs148775834 - CDS Nonsynonymous[Met84Thr]
306 .. 306 C/T rs2618235 - CDS Synonymous[Asn87Asn]
307 .. 307 G/C rs75086964 - CDS Nonsynonymous[Asp88His]
330 .. 330 T/C rs150543829 - CDS Synonymous[Asp95Asp]
332 .. 332 C/A rs148038860 - CDS Nonsynonymous[Ala96Asp]
338 .. 338 G/A rs138779159 - CDS Nonsynonymous[Ser98Asn]
368 .. 368 A/T rs201866753 - CDS Nonsynonymous[Asp108Val]
369 .. 369 C/T rs200691537 - CDS Synonymous[Asp108Asp]
370 .. 370 A/G rs199941425 - CDS Nonsynonymous[Ser109Gly]
372 .. 372 T/C rs201608469 - CDS Synonymous[Ser109Ser]
405 .. 405 C/T rs75143374 - CDS Synonymous[His120His]
425 ^ 426 -/ACA rs200969130 - CDS
431 .. 431 T/C rs80277652 - CDS Nonsynonymous[Met129Thr]
439 .. 439 G/C rs78704688 - CDS Nonsynonymous[Ala132Pro]
444 .. 444 C/T rs200723862 - CDS Synonymous[Leu133Leu]
446 .. 446 T/C rs77747732 - CDS Nonsynonymous[Leu134Ser]
450 .. 450 A/C rs79236443 - CDS Synonymous[Ser135Ser]
456 .. 456 A/G rs78213014 - CDS Synonymous[Gly137Gly]
467 .. 467 A/C rs77938271 - 3'UTR
487 .. 487 G/A rs77117086 - 3'UTR
514 .. 514 A/C rs79420153 - 3'UTR
515 .. 515 G/A rs74887001 - 3'UTR
532 .. 532 T/A rs76094877 - 3'UTR
550 .. 550 C/T rs75462642 - 3'UTR
551 .. 551 G/A rs13412696 - 3'UTR
563 .. 563 G/T rs74403173 - 3'UTR
577 .. 577 A/C rs76030446 - 3'UTR
579 .. 579 C/T rs75344193 - 3'UTR
580 .. 580 G/A rs116073039 - 3'UTR
597 .. 597 T/C rs145714883 - 3'UTR
602 .. 602 C/G rs146456935 - 3'UTR
615 .. 615 A/C rs80198161 - 3'UTR
639 .. 639 A/C rs77046976 - 3'UTR
677 .. 677 T/G rs112292798 - 3'UTR
697 .. 697 G/A rs200270929 + 3'UTR
741 .. 741 T/C rs14234 - 3'UTR
763 .. 763 C/T rs113004836 - 3'UTR
805 .. 805 G/A rs184732776 - 3'UTR
852 .. 852 T/C rs147859234 - 3'UTR
911 .. 911 A/T rs1058256 - 3'UTR
1020 .. 1020 G/T rs144479933 - 3'UTR
1067 .. 1067 T/A rs2169836 - 3'UTR
1084 .. 1084 G/A rs199779428 - 3'UTR
1178 .. 1178 C/T rs200745741 + 3'UTR
1286 .. 1286 G/A rs201562661 + 3'UTR
1404 .. 1404 T/A rs192998668 - 3'UTR
1442 .. 1442 C/T rs201335807 + 3'UTR
1483 .. 1483 C/A rs3860 - 3'UTR
1510 .. 1510 C/T rs112339794 - 3'UTR
1512 .. 1512 A/C rs186742332 - 3'UTR
1513 .. 1513 C/T rs76630026 - 3'UTR
1523 .. 1523 G/T rs79780439 - 3'UTR
1533 .. 1533 C/T rs182407545 - 3'UTR
1650 .. 1650 C/T rs141562939 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer