H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000384281 Accession number: AK225151 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Protein FAM136A;
 
 

Motif information
ORF

length(138),orf(46:462)
MAELQQLRVQEAVESMVKSLERENIRKMQGLMFRCSASCCEDSQASMKQV
HQCIERCHVPLAQAQALVTSELEKFQDRLARCTMHCNDKAKDSIDAGSKE
LQVKQQLDSCVTKCVDDHMHLIPTMTKKMKEALLSIGK*
a.a.
length
InterPro Name
length(138), motif(1:138) 138 IPR008560 Protein of unknown function DUF842, eukaryotic [Family]
length(129), motif(5:133) 129 IPR008560 Protein of unknown function DUF842, eukaryotic [Family]