H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000386894 Accession number: BC113441 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Homeobox protein MIXL1; Homeodomain protein MIX; hMix; MIX1 homeobox-like protein 1; Mix.1 homeobox-like protein;
 
 

Transcript original information
Accession number BC113441.1
CAGE tag ID NA
EST ID NA
Clone Number MGC:142001 IMAGE:8322493
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ;
Sequence data provider NA
Annotation project NA
Length of cDNA 815[bp] (No. of exon:2)[A:129 T:146 G:246 C:294]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Brain, cerebellum, PCR rescued clones
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0028575
Genomic location  G-integra Help Chromosome 1
Location 1q42.12
Position 226411319- 226413565
Strand +
Possible duplicated location(s) NA
Gene structure 2 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:83881
KEGG GENES KEGG GENES(83881)
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000035135
Predicted CDS 65..763;  232[aa];  Orientation:+2; 
Codon Adaptation Index (CAI). 0.742
Database links RefSeq NP_114150
UniProt Q9H2W2
CCDS CCDS1552

Motif information
ORF

length(232),orf(65:763)
MATAESRALQFAEGAAFPAYRAPHAGGALLPPPSPAAALLPAPPAGPGPA
TFAGFLGRDPGPAPPPPASLGSPAPPKGAAAPSASQRRKRTSFSAEQLQL
LELVFRRTRYPDIHLRERLAALTLLPESRIQVWFQNRRAKSRRQSGKSFQ
PLARPEIILNHCAPGTETKCLKPQLPLEVDVNCLPEPNGVGGGISDSSSQ
GQNFETCSPLSEDIGSKLDSWEEHIFSAFGNF*
a.a.
length
InterPro Name
length(65), motif(83:147) 65 IPR009057 Homeodomain-like [Domain]
length(66), motif(83:148) 66 IPR009057 Homeodomain-like [Domain]
length(61), motif(84:144) 61 IPR001356 Homeobox domain [Domain]
length(63), motif(86:148) 63 IPR001356 Homeobox domain [Domain]
length(57), motif(87:143) 57 IPR001356 Homeobox domain [Domain]
length(24), motif(119:142) 24 IPR017970 Homeobox, conserved site [Conserved_site]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000386894
H-Inv cluster ID Locus viewHIX0028575
Accession number BC113441.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Homeobox protein MIXL1; Homeodomain protein MIX; hMix; MIX1 homeobox-like protein 1; Mix.1 homeobox-like protein;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (Q9H2W2)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 11084649120700131548933416433620167104141722408217303500ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol NA
HGNC aliases NA
HGNC name NA
DDBJ MIXL1
UniProt MIXL1
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000035135
No. of interaction NA
Interaction partner(s) NA
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:83881
KEGG GENES KEGG GENES(83881)
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function DNA binding (GO:0003677);  sequence-specific DNA binding (GO:0043565); 
Biological process regulation of transcription, DNA-dependent (GO:0006355); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT nuclear; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
86 155 1b72B 1e-16 22.9 70/73 a.4.1.1
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL blood/spleen/LND; 
Probe
information DNAProbeLocator
AceGene NA
Affymetrix
GeneChip
HG-Focus NA
HG-U133 NA
HG-U133A NA
HG-U133A_2 NA
HG-U133B NA
HG-U133_Plus_2 NA
HG-U95 NA
HG-U95A NA
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 NA
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 NA
Whole Human Genome Oligo Microarray:PGID247 NA
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
368 .. 368 G/C rs202005618 + CDS Nonsynonymous[Glu102Gln]
436 .. 436 G/A rs202018885 + CDS Synonymous[Leu124Leu]
489 .. 489 G/T rs145225693 + CDS Nonsynonymous[Arg142Leu]
558 ^ 559 -/C rs36100504 + CDS
562 .. 562 T/C rs150124070 + CDS Synonymous[Thr166Thr]
584 .. 584 C/T rs79599422 + CDS AA-STOP[Gln174*]
589 .. 589 G/A rs143213308 + CDS Synonymous[Leu175Leu]
613 .. 613 C/T rs3738796 - CDS Synonymous[Cys183Cys]
623 .. 623 C/A rs201172577 + CDS Nonsynonymous[Pro187Thr]
655 .. 655 T/C rs114679749 + CDS Synonymous[Ser197Ser]
664 .. 664 A/C rs200310896 + CDS Nonsynonymous[Gln200His]
689 .. 689 C/T rs151275498 + CDS Nonsynonymous[Pro209Ser]
713 .. 713 A/G rs200659360 + CDS Nonsynonymous[Lys217Glu]
748 .. 748 C/T rs143393232 + CDS Synonymous[Ala228Ala]
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer