H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000386894 Accession number: BC113441 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Homeobox protein MIXL1; Homeodomain protein MIX; hMix; MIX1 homeobox-like protein 1; Mix.1 homeobox-like protein;
 
 

Motif information
ORF

length(232),orf(65:763)
MATAESRALQFAEGAAFPAYRAPHAGGALLPPPSPAAALLPAPPAGPGPA
TFAGFLGRDPGPAPPPPASLGSPAPPKGAAAPSASQRRKRTSFSAEQLQL
LELVFRRTRYPDIHLRERLAALTLLPESRIQVWFQNRRAKSRRQSGKSFQ
PLARPEIILNHCAPGTETKCLKPQLPLEVDVNCLPEPNGVGGGISDSSSQ
GQNFETCSPLSEDIGSKLDSWEEHIFSAFGNF*
a.a.
length
InterPro Name
length(65), motif(83:147) 65 IPR009057 Homeodomain-like [Domain]
length(66), motif(83:148) 66 IPR009057 Homeodomain-like [Domain]
length(61), motif(84:144) 61 IPR001356 Homeobox domain [Domain]
length(63), motif(86:148) 63 IPR001356 Homeobox domain [Domain]
length(57), motif(87:143) 57 IPR001356 Homeobox domain [Domain]
length(24), motif(119:142) 24 IPR017970 Homeobox, conserved site [Conserved_site]