H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000389872 Accession number: BC128462 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Protein TEX261.
 
 

Motif information
ORF

length(196),orf(66:656)
MWFMYLLSWLSLFIQVAFITLAVAAGLYYLAELIEEYTVATSRIIKYMIW
FSTAVLIGLYVFERFPTSMIGVGLFTNLVYFGLLQTFPFIMLTSPNFILS
CGLVVVNHYLAFQFFAEEYYPFSEVLAYFTFCLWIIPFAFFVSLSAGENV
LPSTMQPGDDVVSNYFTKGKRGKRLGILVVFSFIKEAILPSRQKIY*
a.a.
length
InterPro Name
length(187), motif(1:187) 187 IPR007277 Transmembrane adaptor Erv26 [Family]
length(195), motif(2:196) 195 IPR007277 Transmembrane adaptor Erv26 [Family]