H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000394748 Accession number: EF036495 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Alpha-enolase; EC=4.2.1.11; 2-phospho-D-glycerate hydro-lyase; C-myc promoter-binding protein; Enolase 1; MBP-1; MPB-1; Non-neural enolase; NNE; Phosphopyruvate hydratase; Plasminogen-binding protein;
 
 

Transcript original information
Accession number EF036495.1
CAGE tag ID NA
EST ID NA
Clone Number NA
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (ENO1) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (ENO1);
Sequence data provider NA
Annotation project NA
Length of cDNA 500[bp] (No. of exon:5)[A:133 T:110 G:137 C:120]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type NA
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature N/C-truncated
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature Truncation; 
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0000101
Genomic location  G-integra Help Chromosome 1
Location 1p36.23
Position 8926408- 8932033
Strand -
Possible duplicated location(s) NA
Gene structure 5 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:2023
KEGG GENES KEGG GENES(2023)
GeneCard GeneCardENO1*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000177746
Predicted CDS 3..500;  166[aa];  Orientation:+3; 
Codon Adaptation Index (CAI). 0.767

Motif information
ORF

length(166),orf(3:500)
AVPSGASTGIYEALELRDNDKTRYMGKGVSKAVEHINKTIAPALVSKKLN
VTEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCKAGAVEKGVPLYRH
IADLAGNSEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGAANFREAMR
IGAEVYHNLKNVIKEK
a.a.
length
InterPro Name
length(104), motif(1:104) 104 IPR029017 Enolase N-terminal domain-like [Domain]
length(93), motif(1:93) 93 IPR029017 Enolase N-terminal domain-like [Domain]
length(101), motif(1:101) 101 IPR020811 Enolase, N-terminal [Domain]
length(166), motif(1:166) 166 IPR000941 Enolase [Family]
length(15), motif(2:16) 15 IPR000941 Enolase [Family]
length(17), motif(74:90) 17 IPR000941 Enolase [Family]
length(72), motif(95:166) 72 IPR029065 Enolase C-terminal domain-like [Domain]
length(57), motif(110:166) 57 IPR029065 Enolase C-terminal domain-like [Domain]
length(57), motif(110:166) 57 IPR020810 Enolase, C-terminal [Domain]
length(14), motif(131:144) 14 IPR000941 Enolase [Family]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000394748
H-Inv cluster ID Locus viewHIX0000101
Accession number EF036495.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Similar to Alpha-enolase; EC=4.2.1.11; 2-phospho-D-glycerate hydro-lyase; C-myc promoter-binding protein; Enolase 1; MBP-1; MPB-1; Non-neural enolase; NNE; Phosphopyruvate hydratase; Plasminogen-binding protein;
Similarity category  Help Category: Similar to known protein(Category II).
Similar to known protein (P06733)  [Identity/coverage = 100.0%/38.25%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 13692092005901237308135290907787969882471691101749150948930876096536459878089100825541068158910802057111343511149723912297304126661331470203915489334155924551613979816548883167104141681597517974005186696481960886119690332200682312126946021908771ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol ENO1
HGNC aliases NA
HGNC name enolase 1, (alpha)
DDBJ NA
UniProt ENO1
EC number EC 4.2.1.11phosphopyruvate hydratase; 
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway 00010 :Glycolysis / Gluconeogenesis;  00400 :Phenylalanine, tyrosine and tryptophan biosynthesis; 
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000177746
No. of interaction NA
Interaction partner(s) NA
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:2023
KEGG GENES KEGG GENES(2023)
GeneCard GeneCardENO1*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function phosphopyruvate hydratase activity (GO:0004634);  magnesium ion binding (GO:0000287); 
Biological process glycolysis (GO:0006096); 
Cellular component phosphopyruvate hydratase complex (GO:0000015); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT cytosol;  nuclear; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Disease/pathology information  DiseaseInfo Viewer LEGENDA Last modified:27-May-2015
Disease relation Disease name:NA
Related information in OMIM OMIM ID:  172430;  Title: ENOLASE 1
Co-localized orphan diseases NA
Disease related mutation NA
Literature-Extracted GENe-Disease Associations (LEGENDA) LEGENDA Gene name Entrez Gene ID:(2023)
Disease Entrez Gene ID:(2023)
Substance Entrez Gene ID:(2023)
Related H-InvDB links DiseaseInfo ViewerDiseaseInfo ViewerLEGENDALEGENDA

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
28 .. 28 G/C rs11544503 + CDS Nonsynonymous[Gly9Ala]
34 .. 34 A/G rs138834005 - CDS Nonsynonymous[Tyr11Cys]
70 .. 70 G/A rs201990176 - CDS Nonsynonymous[Arg23His]
78 .. 78 G/A rs142310173 - CDS Nonsynonymous[Gly26Arg]
104 .. 104 G/A rs28999074 + CDS Synonymous[Glu34Glu]
107 .. 107 C/T rs201513751 - CDS Synonymous[His35His]
112 .. 112 A/G rs201867667 - CDS Nonsynonymous[Asn37Ser]
126 .. 126 C/A rs146938354 - CDS Nonsynonymous[Pro42Thr]
134 .. 134 G/A rs28999075 + CDS Synonymous[Leu44Leu]
135 .. 135 G/T rs146619828 - CDS Nonsynonymous[Val45Phe]
185 .. 185 G/C rs11544491 + CDS Nonsynonymous[Met61Ile]
196 .. 196 A/G rs201943492 - CDS Nonsynonymous[Asp65Gly]
227 .. 227 G/A rs200935067 - CDS Synonymous[Ala75Ala]
255 .. 255 G/A rs199529530 - CDS Nonsynonymous[Val85Ile]
260 .. 260 C/T rs11544507 + CDS Synonymous[Cys86Cys]
273 .. 273 G/A/C rs11544519 + CDS
299 ^ 300 -/CC rs144538182 - CDS
302 .. 302 C/T rs11544497 + CDS Synonymous[His100His]
320 .. 320 C/A rs142256351 - CDS Synonymous[Gly106Gly]
398 .. 398 G/C rs11544509 + CDS Nonsynonymous[Met132Ile]
434 .. 434 C/A/T rs11544513 + CDS
470 .. 470 C/T rs11544499 + CDS Synonymous[Tyr156Tyr]
472 .. 472 A/G rs201627070 - CDS Nonsynonymous[His157Arg]
489 .. 489 A/G rs199771237 - CDS Nonsynonymous[Ile163Val]
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer