H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000394748 Accession number: EF036495 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Alpha-enolase; EC=4.2.1.11; 2-phospho-D-glycerate hydro-lyase; C-myc promoter-binding protein; Enolase 1; MBP-1; MPB-1; Non-neural enolase; NNE; Phosphopyruvate hydratase; Plasminogen-binding protein;
 
 

Motif information
ORF

length(166),orf(3:500)
AVPSGASTGIYEALELRDNDKTRYMGKGVSKAVEHINKTIAPALVSKKLN
VTEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCKAGAVEKGVPLYRH
IADLAGNSEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGAANFREAMR
IGAEVYHNLKNVIKEK
a.a.
length
InterPro Name
length(104), motif(1:104) 104 IPR029017 Enolase N-terminal domain-like [Domain]
length(93), motif(1:93) 93 IPR029017 Enolase N-terminal domain-like [Domain]
length(101), motif(1:101) 101 IPR020811 Enolase, N-terminal [Domain]
length(166), motif(1:166) 166 IPR000941 Enolase [Family]
length(15), motif(2:16) 15 IPR000941 Enolase [Family]
length(17), motif(74:90) 17 IPR000941 Enolase [Family]
length(72), motif(95:166) 72 IPR029065 Enolase C-terminal domain-like [Domain]
length(57), motif(110:166) 57 IPR029065 Enolase C-terminal domain-like [Domain]
length(57), motif(110:166) 57 IPR020810 Enolase, C-terminal [Domain]
length(14), motif(131:144) 14 IPR000941 Enolase [Family]