H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000425096 Accession number: AK292299 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Presenilin-2; PS-2; EC=3.4.23.-; AD3LP; AD5; E5-1; STM-2; Contains: Presenilin-2 NTF subunit; Contains: Presenilin-2 CTF subunit;
 
 

Transcript original information
Accession number AK292299.1
CAGE tag ID NA
EST ID NA
Clone Number TESTI2018212
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (PSEN2) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (PSEN2);
Sequence data provider NA
Annotation project NA
Length of cDNA 1860[bp] (No. of exon:13)[A:398 T:427 G:532 C:503]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type testis
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) AAGAAG;  CAGAAG; 
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0001647
Genomic location  G-integra Help Chromosome 1
Location 1q42.13
Position 227058321- 227083417
Strand +
Possible duplicated location(s) NA
Gene structure 13 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:5664
KEGG GENES KEGG GENES(5664)
GeneCard GeneCardPSEN2*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000186295
Predicted CDS 380..1723;  447[aa];  Orientation:+2; 
Codon Adaptation Index (CAI). 0.815
Database links RefSeq NP_036618
UniProt NA
CCDS CCDS44324

Motif information
ORF

length(447),orf(380:1723)
MLTFMASDSEEEVCDERTSLMSAESPTPRSCQEGRQGPEDGENTAQWRSQ
ENEEDGEEDPDRYVCSGVPGRPPGLEEELTLKYGAKHVIMLFVPVTLCMI
VVVATIKSVRFYTEKNGQLIYTPFTEDTPSVGQRLLNSVLNTLIMISVIV
VMTIFLVVLYKYRCYKFIHGWLIMSSLMLLFLFTYIYLGEVLKTYNVAMD
YPTLLLTVWNFGAVGMVCIHWKGPLVLQQAYLIMISALMALVFIKYLPEW
SAWVILGAISVYDLVAVLCPKGPLRMLVETAQERNEPIFPALIYSSAMVW
TVGMAKLDPSSQGALQLPYDPEMEDSYDSFGEPSYPEVFEPPLTGYPGEE
LEEEEERGVKLGLGDFIFYSVLVGKAAATGSGDWNTTLACFVAILIGLCL
TLLLLAVFKKALPALPISITFGLIFYFSTDNLVRPFMDTLASHQLYI*
a.a.
length
InterPro Name
length(23), motif(4:26) 23 IPR001493 Peptidase A22A, presenilin 2 [Family]
length(440), motif(8:447) 440 IPR001108 Peptidase A22A, presenilin [Family]
length(12), motif(37:48) 12 IPR001493 Peptidase A22A, presenilin 2 [Family]
length(231), motif(76:306) 231 IPR001108 Peptidase A22A, presenilin [Family]
length(11), motif(92:102) 11 IPR001108 Peptidase A22A, presenilin [Family]
length(298), motif(136:433) 298 IPR006639 Presenilin/signal peptide peptidase [Family]
length(8), motif(246:253) 8 IPR001108 Peptidase A22A, presenilin [Family]
length(18), motif(263:280) 18 IPR001108 Peptidase A22A, presenilin [Family]
length(8), motif(289:296) 8 IPR001108 Peptidase A22A, presenilin [Family]
length(19), motif(306:324) 19 IPR001493 Peptidase A22A, presenilin 2 [Family]
length(17), motif(326:342) 17 IPR001493 Peptidase A22A, presenilin 2 [Family]
length(90), motif(349:438) 90 IPR001108 Peptidase A22A, presenilin [Family]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000425096
H-Inv cluster ID Locus viewHIX0001647
Accession number AK292299.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help Representative H-Inv IDRepresentative transcript;  Splicing isoformSplicing isoform
Coding potential  Help Protein coding; 
Definition Presenilin-2; PS-2; EC=3.4.23.-; AD3LP; AD5; E5-1; STM-2; Contains: Presenilin-2 NTF subunit; Contains: Presenilin-2 CTF subunit;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (P49810)  [Identity/coverage = 99.777%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 76386227651536857496986188678661049938460294370139521418104972361063114110652302107328061179912914702039153855471548933416710414171864611866964820068231ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol PSEN2
HGNC aliases "Alzheimer disease 4"
HGNC name presenilin 2
DDBJ NA
UniProt PSEN2
EC number EC 3.4.23.-Aspartic endopeptidases; 
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000186295
No. of interaction 2
Interaction partner(s) HIP000028058HIP000059101
BIND 177583;  177584;  177585;  177765;  177778;  177779; 
DIP NA
MINT MINT-13994;  MINT-13995;  MINT-14379;  MINT-14380;  MINT-14945;  MINT-14946;  MINT-14947;  MINT-15560;  MINT-15561;  MINT-15562;  MINT-16270;  MINT-16271;  MINT-16272;  MINT-17115;  MINT-17116;  MINT-17615;  MINT-17616;  MINT-17617; 
HPRD 00100;  00253;  00277;  00286;  00977;  01290;  01680;  01827;  02060;  02497;  02524;  02606;  02607;  02739;  02799;  02920;  03188;  03321;  03457;  03459;  03509;  03800;  04543;  04671;  05198;  05232;  05440;  05584;  05715;  06360;  06361;  06362;  06907;  09063;  09181;  09705;  10216;  10341;  10549;  11517;  12184;  12363;  17469; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:5664
KEGG GENES KEGG GENES(5664)
GeneCard GeneCardPSEN2*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Human curated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function aspartic-type endopeptidase activity (GO:0004190); 
Cellular component integral to membrane (GO:0016021);  membrane (GO:0016020); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT plasma membrane;  endoplasmic;  golgi apparatus; 
Target P Other
SOSUI membrane protein
TMHMM membrane protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Disease/pathology information  DiseaseInfo Viewer LEGENDA Last modified:27-May-2015
Disease relation Disease name: Alzheimer disease-4 (606889); 
Related information in OMIM OMIM ID:  600759;  Title: PRESENILIN 2
Co-localized orphan diseases NA
Disease related mutation MutationView:  600759
JRE-1.4.0 or later is required.Download JRE at Sun's web site.
Literature-Extracted GENe-Disease Associations (LEGENDA) LEGENDA Gene name Entrez Gene ID:(5664)
Disease Entrez Gene ID:(5664)
Substance Entrez Gene ID:(5664)
Related H-InvDB links DiseaseInfo ViewerDiseaseInfo ViewerLEGENDALEGENDA

Evolutionary information  Evola Help Last modified:27-May-2015
Relationship Species Accession number MGI Links
Orthology Danio sp. (Zebrafish) AF178539 G-integraG-integra
Orthology Mus sp. (Mouse) AK148111 MGI:3560191 G-integraG-integra
Orthology Gallus sp. (Chicken) AY486554 G-integraG-integra
Orthology Bos sp. (Cow) BC112811 G-integraG-integra
Orthology Tetraodon sp. (Tetraodon) CR647350 G-integraG-integra
Orthology Monodelphis sp. (Opossum) ENSMODT00000036711 G-integraG-integra
Orthology Pongo sp. (Orangutan) ENSPPYT00000000172 G-integraG-integra
Orthology Pan sp. (Chimpanzee) ENSPTRT00000058137 G-integraG-integra
Orthology Takifugu sp. (Fugu) SINFRUT00000172776 G-integraG-integra
Orthology Rattus sp. (Rat) X99267 G-integraG-integra
Orthology Macaca sp. (Macaque) XM_001087264 G-integraG-integra
Orthology Equus sp. (Horse) XM_001489714 G-integraG-integra
Phylogenetic tree [View by ATV]
Neighbor-joining (phb) 
Related H-InvDB links EvolaEvoladN/dS (under constraction); 

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
24 .. 24 A/G rs12758915 + 5'UTR
42 .. 42 A/G rs6665033 + 5'UTR
45 .. 45 G/A/T rs201106517 + 5'UTR
48 .. 48 G/A rs202060347 + 5'UTR
76 .. 76 T/A rs200232829 + 5'UTR
79 .. 79 A/G rs201559176 + 5'UTR
82 .. 82 A/G rs199762553 + 5'UTR
83 .. 83 A/C rs191052430 + 5'UTR
84 .. 84 C/T rs201515227 + 5'UTR
102 .. 102 C/T rs199532840 + 5'UTR
105 .. 105 C/T rs1295645 + 5'UTR
129 .. 129 A/G rs201552337 + 5'UTR
133 .. 133 G/A rs199696668 + 5'UTR
138 .. 138 C/T rs145582210 + 5'UTR
160 .. 160 C/T rs201316014 + 5'UTR
168 .. 168 G/T rs200165480 + 5'UTR
174 .. 174 C/T rs200954447 + 5'UTR
196 .. 196 C/T rs149590162 + 5'UTR
216 .. 216 G/A rs200591275 + 5'UTR
231 .. 231 T/C rs201494032 + 5'UTR
241 .. 241 C/T rs199632838 + 5'UTR
242 .. 242 G/A rs200305467 + 5'UTR
248 .. 248 A/G rs201300501 + 5'UTR
257 .. 257 G/A rs112062360 + 5'UTR
259 .. 259 T/C rs199803697 + 5'UTR
298 .. 298 T/C rs200607063 + 5'UTR
323 .. 323 C/T rs201111506 + 5'UTR
337 .. 337 C/T rs7961 + 5'UTR
342 .. 342 C/T rs200982557 + 5'UTR
343 .. 343 G/A rs201820913 + 5'UTR
359 .. 359 G/T rs200034334 + 5'UTR
383 .. 383 C/G rs199739625 + CDS Nonsynonymous[Leu2Val]
405 .. 405 G/A rs200878942 + CDS Nonsynonymous[Ser9Asn]
406 .. 406 C/T rs201692678 + CDS Synonymous[Ser9Ser]
428 .. 428 C/T rs199644116 + CDS Nonsynonymous[Arg17Trp]
432 .. 432 C/T rs143061887 + CDS Nonsynonymous[Thr18Met]
433 .. 433 G/A rs201018913 + CDS Synonymous[Thr18Thr]
448 .. 448 C/T rs11405 + CDS Synonymous[Ala23Ala]
458 .. 458 A/G rs147326133 + CDS Nonsynonymous[Thr27Ala]
459 .. 459 C/T rs149354305 + CDS Nonsynonymous[Thr27Met]
460 .. 460 G/A rs144696679 + CDS Synonymous[Thr27Thr]
464 .. 464 C/T rs142892469 + CDS Nonsynonymous[Arg29Cys]
468 .. 468 C/T rs200037771 + CDS Nonsynonymous[Ser30Phe]
479 .. 479 G/A rs200636353 + CDS Nonsynonymous[Gly34Ser]
490 .. 490 C/T rs139309459 + CDS Synonymous[Gly37Gly]
508 .. 508 T/C rs6759 + CDS Synonymous[Asn43Asn]
509 .. 509 A/G rs200535276 + CDS Nonsynonymous[Thr44Ala]
511 .. 511 T/A rs143227762 + CDS Synonymous[Thr44Thr]
528 .. 528 A/G rs143501870 + CDS Nonsynonymous[Gln50Arg]
541 .. 541 G/C rs146894466 + CDS Nonsynonymous[Glu54Asp]
544 .. 544 C/T rs139332886 + CDS Synonymous[Asp55Asp]
545 .. 545 G/A rs188598190 + CDS Nonsynonymous[Gly56Ser]
562 .. 562 C/T rs201261403 + CDS Synonymous[Asp61Asp]
563 .. 563 C/T rs150400387 + CDS Nonsynonymous[Arg62Cys]
564 .. 564 G/A rs58973334 + CDS Nonsynonymous[Arg62His]
571 .. 571 C/T rs201272715 + CDS Synonymous[Val64Val]
584 .. 584 C/G/T rs202133351 + CDS
585 .. 585 C/G rs199968912 + CDS Nonsynonymous[Pro69Arg]
586 .. 586 C/T rs142546082 + CDS Synonymous[Pro69Pro]
587 .. 587 G/A rs139972151 + CDS Nonsynonymous[Gly70Arg]
590 .. 590 C/T rs140501902 + CDS Nonsynonymous[Arg71Trp]
633 .. 633 C/T rs63750048 + CDS Nonsynonymous[Ala85Val]
640 .. 640 T/C rs1046240 + CDS Synonymous[His87His]
658 .. 658 G/C rs200350640 + CDS Synonymous[Val93Val]
673 .. 673 C/T rs146718524 + CDS Synonymous[Cys98Cys]
679 .. 679 C/T rs200801915 + CDS Synonymous[Ile100Ile]
707 .. 707 C/T rs199808788 + CDS Nonsynonymous[Arg110Cys]
715 .. 715 C/T rs200610057 + CDS Synonymous[Tyr112Tyr]
727 .. 727 T/C rs201119121 + CDS Synonymous[Asn116Asn]
743 .. 743 A/C rs63749851 + CDS Nonsynonymous[Thr122Pro]
744 .. 744 C/G rs28936380 + CDS Nonsynonymous[Thr122Arg]
745 .. 745 G/A rs148996705 + CDS Synonymous[Thr122Thr]
768 .. 768 C/T rs63750197 + CDS Nonsynonymous[Ser130Leu]
790 .. 790 C/T rs200924879 + CDS Synonymous[Asn137Asn]
794 .. 794 G/A rs202178897 + CDS Nonsynonymous[Val139Met]
800 .. 800 A/T rs61761208 + CDS Nonsynonymous[Asn141Tyr]
801 .. 801 A/T rs63750215 + CDS Nonsynonymous[Asn141Ile]
802 .. 802 C/T rs116003409 + CDS Synonymous[Asn141Asn]
803 .. 803 A/T rs201590095 + CDS Nonsynonymous[Thr142Ser]
808 .. 808 C/T rs201196514 + CDS Synonymous[Leu143Leu]
818 .. 818 A/G rs201892898 + CDS Nonsynonymous[Ser147Gly]
820 .. 820 C/T rs114334281 + CDS Synonymous[Ser147Ser]
821 .. 821 G/A rs63750812 + CDS Nonsynonymous[Val148Ile]
834 .. 834 T/C rs199654606 + CDS Nonsynonymous[Met152Thr]
839 .. 839 A/G rs139573101 + CDS Nonsynonymous[Ile154Val]
866 .. 866 C/A rs200931244 + CDS Nonsynonymous[Arg163Ser]
899 .. 899 A/G rs61757781 + CDS Nonsynonymous[Met174Val]
916 .. 916 G/A rs201896763 + CDS Synonymous[Leu179Leu]
930 .. 930 C/T rs200210453 + CDS Nonsynonymous[Thr184Ile]
949 .. 949 A/C rs202176021 + CDS Nonsynonymous[Glu190Asp]
963 .. 963 A/G rs200410369 + CDS Nonsynonymous[Tyr195Cys]
967 .. 967 T/C rs144629723 + CDS Synonymous[Asn196Asn]
1010 .. 1010 T/G rs201671829 + CDS Nonsynonymous[Phe211Val]
1012 .. 1012 C/T rs199760083 + CDS Synonymous[Phe211Phe]
1013 .. 1013 G/A rs200173519 + CDS Nonsynonymous[Gly212Arg]
1021 .. 1021 G/T rs190477948 + CDS Synonymous[Val214Val]
1062 .. 1062 A/T rs63750880 + CDS Nonsynonymous[Gln228Leu]
1069 .. 1069 C/G rs145010538 + CDS Synonymous[Ala230Ala]
1071 .. 1071 A/G rs200754713 + CDS Nonsynonymous[Tyr231Cys]
1076 .. 1076 A/G rs201908554 + CDS Nonsynonymous[Ile233Val]
1087 .. 1087 T/C rs61730652 + CDS Synonymous[Ser236Ser]
1089 .. 1089 C/T rs200670135 + CDS Nonsynonymous[Ala237Val]
1090 .. 1090 G/A rs202003390 + CDS Synonymous[Ala237Ala]
1094 .. 1094 A/G rs28936379 + CDS Nonsynonymous[Met239Val]
1096 .. 1096 G/A rs63749884 + CDS Nonsynonymous[Met239Ile]
1104 .. 1104 T/C rs200133314 + CDS Nonsynonymous[Val242Ala]
1118 .. 1118 C/T rs140562931 + CDS Nonsynonymous[Leu247Phe]
1123 .. 1123 A/G rs145400391 + CDS Synonymous[Pro248Pro]
1132 .. 1132 C/T rs200332829 + CDS Synonymous[Ser251Ser]
1133 .. 1133 G/A rs138836272 + CDS Nonsynonymous[Ala252Thr]
1134 .. 1134 C/T rs201403206 + CDS Nonsynonymous[Ala252Val]
1135 .. 1135 G/C rs147702142 + CDS Synonymous[Ala252Ala]
1142 .. 1142 A/T rs201292728 + CDS Nonsynonymous[Ile255Phe]
1150 .. 1150 C/T rs7539017 + CDS Synonymous[Gly257Gly]
1151 .. 1151 G/A/T rs148238688 + CDS
1160 .. 1160 G/C rs201055590 + CDS Nonsynonymous[Val261Leu]
1162 .. 1162 G/A rs202210060 + CDS Synonymous[Val261Val]
1169 .. 1169 C/T rs200694973 + CDS Nonsynonymous[Leu264Phe]
1171 .. 1171 C/G rs77875620 + CDS Synonymous[Leu264Leu]
1172 .. 1172 G/A rs199707432 + CDS Nonsynonymous[Val265Met]
1177 .. 1177 T/C rs200644982 + CDS Synonymous[Ala266Ala]
1179 .. 1179 T/G rs77421307 + CDS Nonsynonymous[Val267Gly]
1183 .. 1183 G/C rs201606093 + CDS Synonymous[Leu268Leu]
1233 .. 1233 A/G rs150780392 + CDS Nonsynonymous[Asn285Ser]
1240 .. 1240 C/T rs75733498 + CDS Synonymous[Pro287Pro]
1256 .. 1256 A/T rs199689738 + CDS Nonsynonymous[Ile293Leu]
1263 .. 1263 C/T rs200668817 + CDS Nonsynonymous[Ser295Leu]
1281 .. 1281 C/T rs144277432 + CDS Nonsynonymous[Thr301Met]
1282 .. 1282 G/A/T rs6426553 + CDS
1293 .. 1293 C/T rs200501733 + CDS Nonsynonymous[Ala305Val]
1294 .. 1294 G/A rs75357954 + CDS Synonymous[Ala305Ala]
1306 .. 1306 C/T rs200326485 + CDS Synonymous[Pro309Pro]
1326 .. 1326 A/G rs201778576 + CDS Nonsynonymous[Gln316Arg]
1333 .. 1333 C/T rs199587016 + CDS Synonymous[Pro318Pro]
1337 .. 1337 G/A rs141094783 + CDS Nonsynonymous[Asp320Asn]
1369 .. 1369 T/C/G rs200044441 + CDS
1377 .. 1377 C/G rs63750207 + CDS Nonsynonymous[Pro333Arg]
1391 .. 1391 G/A rs201917728 + CDS Nonsynonymous[Val338Ile]
1399 .. 1399 G/A rs199881176 + CDS Synonymous[Glu340Glu]
1425 .. 1425 A/G rs78420366 + CDS Nonsynonymous[Glu349Gly]
1444 .. 1444 G/A rs200977587 + CDS Synonymous[Glu355Glu]
1468 .. 1468 C/T rs201093218 + CDS Synonymous[Leu363Leu]
1506 .. 1506 C/T rs199714082 + CDS Nonsynonymous[Ala376Val]
1515 .. 1515 C/A rs143912759 + CDS Nonsynonymous[Thr379Lys]
1524 .. 1524 G/A rs145671982 + CDS Nonsynonymous[Gly382Glu]
1525 .. 1525 G/C rs201772526 + CDS Synonymous[Gly382Gly]
1528 .. 1528 C/G rs199550349 + CDS Nonsynonymous[Asp383Glu]
1532 .. 1532 A/C rs149172004 + CDS Nonsynonymous[Asn385His]
1539 .. 1539 C/T rs143549266 + CDS Nonsynonymous[Thr387Met]
1552 .. 1552 C/T rs115652716 + CDS Synonymous[Phe391Phe]
1553 .. 1553 G/A rs142690225 + CDS Nonsynonymous[Val392Met]
1576 .. 1576 T/C rs138494303 + CDS Synonymous[Cys399Cys]
1612 .. 1612 G/A rs201982084 + CDS Synonymous[Ala411Ala]
1616 .. 1616 C/T rs200427880 + CDS Nonsynonymous[Pro413Ser]
1619 .. 1619 G/A rs201494033 + CDS Nonsynonymous[Ala414Thr]
1628 .. 1628 A/G rs199796978 + CDS Nonsynonymous[Ile417Val]
1642 .. 1642 C/T rs200169735 + CDS Synonymous[Phe421Phe]
1660 .. 1660 C/T rs144318314 + CDS Synonymous[Phe427Phe]
1665 .. 1665 C/T rs63750666 + CDS Nonsynonymous[Thr429Met]
1670 .. 1670 A/C rs199676786 + CDS Nonsynonymous[Asn431His]
1679 .. 1679 C/T rs142772982 + CDS Nonsynonymous[Arg434Trp]
1680 .. 1680 G/A rs201922151 + CDS Nonsynonymous[Arg434Gln]
1684 .. 1684 G/A rs199547508 + CDS Synonymous[Pro435Pro]
1688 .. 1688 A/G rs200804459 + CDS Nonsynonymous[Met437Val]
1692 .. 1692 A/C rs63750110 + CDS Nonsynonymous[Asp438Ala]
1693 .. 1693 C/T rs201424233 + CDS Synonymous[Asp438Asp]
1706 .. 1706 C/T rs151048692 + CDS Nonsynonymous[His443Tyr]
1726 .. 1726 G/A rs200164062 + 3'UTR
1741 .. 1741 A/G rs200745703 + 3'UTR
1743 .. 1743 G/A rs201399057 + 3'UTR
1767 .. 1767 T/C rs200016565 + 3'UTR
1804 .. 1804 A/T rs200943229 + 3'UTR
1817 .. 1817 T/C rs202239448 + 3'UTR
1843 .. 1843 G/A rs143059995 + 3'UTR
1855 .. 1855 T/C rs186288674 + 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
Type Start End Strand
MIR3 72 177 -
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer