H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000426775 Accession number: AK307909 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to WD repeat-containing protein 26; CUL4- and DDB1-associated WDR protein 2; Myocardial ischemic preconditioning up-regulated protein 2;
 
 

Transcript original information
Accession number AK307909.1
CAGE tag ID NA
EST ID NA
Clone Number BRTHA2011345
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (WDR26) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (WDR26);
Sequence data provider NA
Annotation project NA
Length of cDNA 1306[bp] (No. of exon:7)[A:316 T:332 G:322 C:336]
Devision HTC
Molecular type mRNA
Library origin Cell type NA
Tissue type thalamus
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature N-truncated
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0001629
Genomic location  G-integra Help Chromosome 1
Location 1q42.11-1q42.12
Position 224600611- 224621715
Strand -
Possible duplicated location(s) NA
Gene structure 7 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:80232
KEGG GENES KEGG GENES(80232)
GeneCard GeneCardWDR26*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000354436
Predicted CDS 2..670;  222[aa];  Orientation:+2; 
Codon Adaptation Index (CAI). 0.707

Motif information
ORF

length(222),orf(2:670)
LACLSAQNGESSPSSSSSAGDLAHANGLLPSAPSAASNSSNSLNVNNGVP
GGAAAASSATVAAASATTAASSSLATPELGSSLKKKKRLSQSDEDVIRLI
GQHLNGLGLNQTVDLLMQESGCRLEHPSATKFRNHVMEGDWDKAENDLNE
LKPLVHSPHAIVRMKFLLLQQKYLEYLEDGKVLEALQVLRCELTPLKYNT
ERIHVLSGYLMCSHAEDLRAKA*
a.a.
length
InterPro Name
length(33), motif(92:124) 33 IPR006594 LIS1 homology motif [Domain]
length(60), motif(125:184) 60 IPR006595 CTLH, C-terminal LisH motif [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000426775
H-Inv cluster ID Locus viewHIX0001629
Accession number AK307909.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO;  Splicing isoformSplicing isoform
Coding potential  Help Protein coding; 
Definition Similar to WD repeat-containing protein 26; CUL4- and DDB1-associated WDR protein 2; Myocardial ischemic preconditioning up-regulated protein 2;
Similarity category  Help Category: Similar to known protein(Category II).
Similar to known protein (Q9H7D7)  [Identity/coverage = 99.317%/46.75%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 14702039153786031548933416710414170415881708198318669648200682312126946021406692ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol WDR26
HGNC aliases NA
HGNC name WD repeat domain 26
DDBJ NA
UniProt WDR26
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000354436
No. of interaction 2
Interaction partner(s) HIP000093435HIP000360879
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:80232
KEGG GENES KEGG GENES(80232)
GeneCard GeneCardWDR26*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function protein binding (GO:0005515); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT nuclear;  cytosol; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
102 .. 102 C/T rs202137376 - CDS Nonsynonymous[Ser34Phe]
178 .. 178 C/T rs202205027 + CDS Synonymous[Ala59Ala]
451 .. 451 A/G rs144989360 - CDS Synonymous[Glu150Glu]
622 .. 622 T/C rs150512167 - CDS Synonymous[Ser207Ser]
645 .. 645 C/T rs148488238 - CDS Nonsynonymous[Ala215Val]
646 .. 646 A/G rs142827296 - CDS Synonymous[Ala215Ala]
697 .. 697 A/G rs151192141 - 3'UTR
700 .. 700 T/C rs143097789 - 3'UTR
713 .. 713 A/G rs139095966 - 3'UTR
786 .. 786 T/G rs77585756 - 3'UTR
789 .. 789 A/G rs77704730 - 3'UTR
801 .. 801 A/G rs200825616 - 3'UTR
814 .. 814 T/C rs148170824 - 3'UTR
865 .. 865 C/T rs140689711 - 3'UTR
889 .. 889 T/C rs148642197 - 3'UTR
997 .. 997 T/G rs10916613 - 3'UTR
1006 .. 1006 G/T rs28482381 - 3'UTR
1007 .. 1007 T/G rs10916612 - 3'UTR
1012 .. 1012 T/G rs61825766 - 3'UTR
1036 .. 1036 T/C rs180877298 - 3'UTR
1121 .. 1121 G/A rs115471257 - 3'UTR
1144 .. 1144 G/C rs12069571 - 3'UTR
1252 .. 1252 G/A rs144827560 - 3'UTR
1278 .. 1278 G/C rs188334446 - 3'UTR
1287 .. 1287 G/A rs186219317 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
Type Start End Strand
AluSx 1007 1306 -
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer