H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000426775 Accession number: AK307909 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to WD repeat-containing protein 26; CUL4- and DDB1-associated WDR protein 2; Myocardial ischemic preconditioning up-regulated protein 2;
 
 

Motif information
ORF

length(222),orf(2:670)
LACLSAQNGESSPSSSSSAGDLAHANGLLPSAPSAASNSSNSLNVNNGVP
GGAAAASSATVAAASATTAASSSLATPELGSSLKKKKRLSQSDEDVIRLI
GQHLNGLGLNQTVDLLMQESGCRLEHPSATKFRNHVMEGDWDKAENDLNE
LKPLVHSPHAIVRMKFLLLQQKYLEYLEDGKVLEALQVLRCELTPLKYNT
ERIHVLSGYLMCSHAEDLRAKA*
a.a.
length
InterPro Name
length(33), motif(92:124) 33 IPR006594 LIS1 homology motif [Domain]
length(60), motif(125:184) 60 IPR006595 CTLH, C-terminal LisH motif [Domain]