H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000426828 Accession number: AK307962 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Heterogeneous nuclear ribonucleoprotein K; hnRNP K;
 
 

Transcript original information
Accession number AK307962.1
CAGE tag ID NA
EST ID NA
Clone Number FCBBF3002131
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ;
Sequence data provider NA
Annotation project NA
Length of cDNA 1285[bp] (No. of exon:15)[A:356 T:317 G:342 C:270]
Devision HTC
Molecular type mRNA
Library origin Cell type NA
Tissue type brain
Develpmental stage fetal
Mini-G
Sequence quality information
CDS feature N-truncated
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature Truncation; 
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0008131
Genomic location  G-integra Help Chromosome 9
Location 9q21.32
Position 86585200- 86595131
Strand -
Possible duplicated location(s) NA
Gene structure 15 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:3190
KEGG GENES KEGG GENES(3190)
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000194198
Predicted CDS 166..1095;  309[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.735

Motif information
ORF

length(309),orf(166:1095)
KNMETEQPEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIK
ALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEGLQLPS
PTATSQLPLESDAVECLNYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAK
IKELRENTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISES
PIKGRAQPYDPNFYDETYDYGGFTMMFDDRRGRPVGFPMRGRGGFDRMPP
GRGGRPMPPSRRDYDDMSPRRGPPPRGGDLMAYDRRGGDLETVTTAWLVS
VLMKLGTLQ*
a.a.
length
InterPro Name
length(19), motif(9:27) 19 IPR012987 ROK, N-terminal [Domain]
length(73), motif(22:94) 73 IPR004088 K Homology domain, type 1 [Domain]
length(69), motif(25:93) 69 IPR004087 K Homology domain [Domain]
length(63), motif(26:88) 63 IPR004088 K Homology domain, type 1 [Domain]
length(59), motif(29:87) 59 IPR004088 K Homology domain, type 1 [Domain]
length(80), motif(125:204) 80 IPR004088 K Homology domain, type 1 [Domain]
length(81), motif(126:206) 81 IPR004088 K Homology domain, type 1 [Domain]
length(72), motif(127:198) 72 IPR004087 K Homology domain [Domain]
length(66), motif(128:193) 66 IPR004088 K Homology domain, type 1 [Domain]
length(63), motif(131:193) 63 IPR004088 K Homology domain, type 1 [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000426828
H-Inv cluster ID Locus viewHIX0008131
Accession number AK307962.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Similar to Heterogeneous nuclear ribonucleoprotein K; hnRNP K;
Similarity category  Help Category: Similar to known protein(Category II).
Similar to known protein (Q5ZIQ3)  [Identity/coverage = 94.562%/83.14%] to Gallus gallus (Chicken). protein.
Experimental evidence Protein evidence
PubMed ID 15642098ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol NA
HGNC aliases NA
HGNC name NA
DDBJ NA
UniProt HNRNPK
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000194198
No. of interaction 1
Interaction partner(s) HIP000338991
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:3190
KEGG GENES KEGG GENES(3190)
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function nucleic acid binding (GO:0003676);  RNA binding (GO:0003723); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT cytosol;  nuclear; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Twilight zone
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
18 97 2cpqA1 4e-11 14.1 78/78 d.51.1.1
126 233 2dp9A1 1e-17 11.0 100/120 b.122.1.5
Related H-InvDB links GTOP GTOP

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
62 .. 62 A/G rs296887 + 5'UTR
69 .. 69 C/A rs201348285 - 5'UTR
118 .. 118 C/G rs167203 + 5'UTR
122 .. 122 T/C rs150285449 - 5'UTR
156 .. 156 C/T rs111648912 - 5'UTR
164 .. 164 A/G rs11548842 + 5'UTR
171 .. 171 T/A rs138667733 - CDS Nonsynonymous[Asn2Lys]
177 .. 177 A/G rs202064506 - CDS Synonymous[Glu4Glu]
187 .. 187 C/T rs150076109 - CDS Nonsynonymous[Pro8Ser]
360 .. 360 C/T rs201251896 - CDS Synonymous[Ser65Ser]
438 .. 438 C/T rs11548846 + CDS Synonymous[Thr91Thr]
503 .. 503 C/G rs140707980 - CDS Nonsynonymous[Ala113Gly]
552 .. 552 C/T rs116557087 - CDS Synonymous[Cys129Cys]
636 .. 636 C/T rs143811423 - CDS Synonymous[Asn157Asn]
645 .. 645 C/G rs201881795 - CDS Synonymous[Thr160Thr]
710 .. 710 A/G rs111725016 - CDS Nonsynonymous[Lys182Arg]
807 .. 807 C/T rs200783060 - CDS Synonymous[Tyr214Tyr]
1031 .. 1031 A/G rs140679593 - CDS Nonsynonymous[Asp289Gly]
1109 .. 1109 A/T rs114279043 - 3'UTR
1149 .. 1149 G/C rs182293768 - 3'UTR
1166 .. 1166 T/C rs143712714 - 3'UTR
1187 .. 1187 T/C rs181141777 - 3'UTR
1253 .. 1253 T/C rs115527397 - 3'UTR
1283 .. 1283 A/G rs61755088 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer