H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000427042 Accession number: AK308176 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Eukaryotic translation initiation factor 5B; eIF-5B; Translation initiation factor IF-2;
 
 

Transcript original information
Accession number AK308176.1
CAGE tag ID NA
EST ID NA
Clone Number PLACE7007577
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (EIF5B) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (EIF5B);
Sequence data provider NA
Annotation project NA
Length of cDNA 3394[bp] (No. of exon:21)[A:1333 T:684 G:874 C:503]
Devision HTC
Molecular type mRNA
Library origin Cell type NA
Tissue type placenta
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature N/C-truncated
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) AAGAAG;  CAGAAG;  TAGTAG; 
Transcript quality feature Truncation; 
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0002308
Genomic location  G-integra Help Chromosome 2
Location 2q11.2
Position 99953852- 100011320
Strand +
Possible duplicated location(s) NA
Gene structure 21 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:9669
KEGG GENES KEGG GENES(9669)
GeneCard GeneCardEIF5B*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000194386
Predicted CDS 1142..3394;  751[aa];  Orientation:+2; 
Codon Adaptation Index (CAI). 0.701

Motif information
ORF

length(751),orf(1142:3394)
EEKEKEKKKGPSKATVKAMQEALAKLKEEEERQKREEEERIKRLEELEAK
RKEEERLEQEKRERKKQKEKERKERLKKEGKLLTKSQREARARAEATLKL
LQAQGVEVPSKDSLPKKRPIYEDKKRKKIPQQLESKEVSESMELCAAVEV
MEQGVPEKEETPPPVEPEEEEDTEDAGLDDWEAMASDEETEKVEGNKVHI
EVKENPEEEEEEEEEEEEDEESEEEEEEEGESEGSEGDEEDEKVSDEKDS
GKTLDKKPSKEMSSDSEYDSDDDRTKEERAYDKAKRRIEKRRLEHSKNVN
TEKLRAPIICVLGHVGTGKTKILDKLRHTHVQDGEAGGITQQIGATNVPL
EAINEQTKMIKNFDRENVRIPGMLIIDTPGHESFSNLRNRGSSLCDIAIL
VVDIMHGLEPQTIESINLLKSKKCPFIVALNKTDRLYDWKKSPDSDVAAT
LKKQKKNTKDEFEERAKAIIVEFAQQGLNAALFYENKDPRTFVSLVPTSA
HTGDGMGSLIYLLVELTQTMLSKRLAHCEELRAQVMEVKALPGMGTTIDV
ILINGRLKEGDTIIVPGVEGPIVTQIRGLLLPPPMKELRVKNQYEKHKEV
EAAQGVKILGKDLEKTLAGLPLLVAYKEDEIPVLKDELIHELKQTLNAIK
LEEKGVYVQASTLGSLEALLEFLKTSEVPYAGINIGPVHKKDVMKASVML
EHDPQYAVILAFDVRIERDAQEMADSLGVRIFSAEIIYHLFDAFTKYRQD
Y
a.a.
length
InterPro Name
length(228), motif(293:520) 228 IPR027417 P-loop containing nucleoside triphosphate hydrolase [Domain]
length(299), motif(297:595) 299 IPR027417 P-loop containing nucleoside triphosphate hydrolase [Domain]
length(211), motif(307:517) 211 IPR000795 Elongation factor, GTP-binding domain [Domain]
length(14), motif(308:321) 14 IPR000795 Elongation factor, GTP-binding domain [Domain]
length(146), motif(309:454) 146 IPR005225 Small GTP-binding protein domain [Domain]
length(11), motif(374:384) 11 IPR000795 Elongation factor, GTP-binding domain [Domain]
length(12), motif(390:401) 12 IPR000795 Elongation factor, GTP-binding domain [Domain]
length(10), motif(426:435) 10 IPR000795 Elongation factor, GTP-binding domain [Domain]
length(75), motif(545:619) 75 IPR004161 Translation elongation factor EFTu/EF1A, domain 2 [Domain]
length(112), motif(639:750) 112 IPR023115 Translation initiation factor IF- 2, domain 3 [Domain]
length(106), motif(640:745) 106 IPR023115 Translation initiation factor IF- 2, domain 3 [Domain]
length(78), motif(655:732) 78 IPR023115 Translation initiation factor IF- 2, domain 3 [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000427042
H-Inv cluster ID Locus viewHIX0002308
Accession number AK308176.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Similar to Eukaryotic translation initiation factor 5B; eIF-5B; Translation initiation factor IF-2;
Similarity category  Help Category: Similar to known protein(Category II).
Similar to known protein (O60841)  [Identity/coverage = 99.628%/88.2%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 987245210200264104323051112470315815621170819831748792117924679179740051808808718318008186696481936772019690332200682312126946021406692ALL
Gene family/group Gene family H-Inv gene family/group ID HIF0001788
Gene family/group name Ribosomal protein L30, ferredoxin-like fold domain (IPR016082).
Evidence motif (InterPro) ID 3
Gene symbol/name HGNC symbol EIF5B
HGNC aliases NA
HGNC name eukaryotic translation initiation factor 5B
DDBJ NA
UniProt EIF5B
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000194386
No. of interaction 20
Interaction partner(s) HIP000021550HIP000022756HIP000023351HIP000031067HIP000034709HIP000047547HIP000051441HIP000051510HIP000061576HIP000069738HIP000087949HIP000097730HIP000098568HIP000101126HIP000107876HIP000132401HIP000148859HIP000181513HIP000321221HIP000339211
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:9669
KEGG GENES KEGG GENES(9669)
GeneCard GeneCardEIF5B*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Ribosomal protein L30, ferredoxin-like fold domain (IPR016082). Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function GTP binding (GO:0005525);  GTPase activity (GO:0003924); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT cytosol;  nuclear; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
65 .. 65 C/G rs192078616 + 5'UTR
108 .. 108 C/G rs138694732 + 5'UTR
157 .. 157 T/C rs183989818 + 5'UTR
173 .. 173 A/G rs11547670 + 5'UTR
316 .. 316 G/A rs41280587 + 5'UTR
318 .. 318 A/C rs201319020 + 5'UTR
378 .. 378 G/A rs189331174 + 5'UTR
404 .. 404 G/T rs114030806 + 5'UTR
430 .. 430 A/T rs201274732 + 5'UTR
529 .. 529 A/C rs112337722 + 5'UTR
539 .. 539 A/G rs201058940 + 5'UTR
638 .. 638 A/G rs200355647 + 5'UTR
776 .. 776 C/G rs199960647 + 5'UTR
823 .. 823 T/A rs201879439 + 5'UTR
826 .. 826 C/T rs201286460 + 5'UTR
830 .. 830 T/G rs200249768 + 5'UTR
850 .. 850 G/A rs12233086 + 5'UTR
876 .. 876 A/T rs201583340 + 5'UTR
1032 .. 1032 C/G rs200353540 + 5'UTR
1055 .. 1055 G/A rs199694603 + 5'UTR
1102 .. 1102 C/A rs74430561 + 5'UTR
1171 .. 1171 A/C rs71413834 + CDS Synonymous[Gly10Gly]
1175 .. 1175 A/G rs10642 + CDS Nonsynonymous[Ser12Gly]
1177 .. 1177 C/A rs75521402 + CDS Nonsynonymous[Ser12Arg]
1184 .. 1184 A/T rs11547668 + CDS Nonsynonymous[Thr15Ser]
1231 .. 1231 A/G rs17352888 + CDS Synonymous[Glu30Glu]
1244 .. 1244 A/G rs3205296 - CDS Nonsynonymous[Arg35Gly]
1279 .. 1279 A/G rs1801875 + CDS Synonymous[Glu46Glu]
1301 .. 1301 G/A rs199730736 + CDS Nonsynonymous[Glu54Lys]
1333 .. 1333 G/A rs3208852 - CDS Synonymous[Arg64Arg]
1352 .. 1352 G/A rs1135362 - CDS Nonsynonymous[Glu71Lys]
1356 .. 1356 G/A rs1135361 - CDS Nonsynonymous[Arg72Lys]
1381 .. 1381 G/T rs117138860 + CDS Synonymous[Gly80Gly]
1383 .. 1383 A/G rs199686500 + CDS Nonsynonymous[Lys81Arg]
1432 .. 1432 T/C rs139598770 + CDS Synonymous[Thr97Thr]
1452 .. 1452 A/C rs190999744 + CDS Nonsynonymous[Gln104Pro]
1516 .. 1516 G/A rs3205291 - CDS Synonymous[Lys125Lys]
1528 .. 1528 A/G rs199551427 + CDS Nonsynonymous[Ile129Met]
1565 .. 1565 A/G rs147438767 + CDS Nonsynonymous[Met142Val]
1574 .. 1574 T/C rs199806211 + CDS Nonsynonymous[Cys145Arg]
1656 .. 1656 A/G rs202035862 + CDS Nonsynonymous[Asp172Gly]
1664 .. 1664 G/A rs201564019 + CDS Nonsynonymous[Asp175Asn]
1731 .. 1731 A/C/G/T rs7558074 + CDS
1800 .. 1800 A/G rs201864125 + CDS Nonsynonymous[Glu220Gly]
1928 .. 1928 A/G/T rs111801819 + CDS
1987 .. 1987 C/G rs182287715 + CDS Nonsynonymous[Asp282Glu]
1998 .. 1998 G/A rs149537328 + CDS Nonsynonymous[Arg286Gln]
2013 .. 2013 G/A rs192772936 + CDS Nonsynonymous[Arg291Gln]
2016 .. 2016 G/A rs200234310 + CDS Nonsynonymous[Arg292Gln]
2043 .. 2043 C/A rs115723036 + CDS Nonsynonymous[Thr301Asn]
2044 .. 2044 C/T rs11896520 + CDS Synonymous[Thr301Thr]
2092 ^ 2093 -/G rs34091582 + CDS
2140 .. 2140 T/C rs1376443 - CDS Synonymous[Asp333Asp]
2141 .. 2141 G/A rs189351546 + CDS Nonsynonymous[Gly334Ser]
2164 .. 2164 A/G rs200683998 + CDS Synonymous[Gln341Gln]
2237 .. 2237 G/A rs79534644 + CDS Nonsynonymous[Glu366Lys]
2247 .. 2247 G/A rs202124160 + CDS Nonsynonymous[Arg369Gln]
2333 .. 2333 G/T rs184913304 + CDS Nonsynonymous[Ala398Ser]
2398 .. 2398 C/A rs201277682 + CDS Synonymous[Leu419Leu]
2446 .. 2446 G/A rs187237106 + CDS Synonymous[Arg435Arg]
2466 .. 2466 G/A rs200883389 + CDS Nonsynonymous[Ser442Asn]
2546 .. 2546 A/G rs192420726 + CDS Nonsynonymous[Ile469Val]
2547 .. 2547 T/C rs140396316 + CDS Nonsynonymous[Ile469Thr]
2575 .. 2575 G/A rs187135905 + CDS Synonymous[Leu478Leu]
2783 .. 2783 A/G rs191568464 + CDS Nonsynonymous[Ile548Val]
2785 .. 2785 A/G rs138045797 + CDS Nonsynonymous[Ile548Met]
2836 ^ 2837 -/C rs35199153 + CDS
2931 .. 2931 A/G rs200197574 + CDS Nonsynonymous[His597Arg]
2939 .. 2939 G/T rs3205290 - CDS Nonsynonymous[Val600Leu]
3049 .. 3049 T/C rs199674726 + CDS Synonymous[Asp636Asp]
3127 .. 3127 A/G rs3197957 - CDS Synonymous[Thr662Thr]
3130 .. 3130 G/A rs149654810 + CDS Synonymous[Leu663Leu]
3267 .. 3267 T/A rs17853071 + CDS Nonsynonymous[Ile709Asn]
3375 .. 3375 C/A rs76992586 + CDS Nonsynonymous[Thr745Lys]
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer