H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000427042 Accession number: AK308176 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Eukaryotic translation initiation factor 5B; eIF-5B; Translation initiation factor IF-2;
 
 

Motif information
ORF

length(751),orf(1142:3394)
EEKEKEKKKGPSKATVKAMQEALAKLKEEEERQKREEEERIKRLEELEAK
RKEEERLEQEKRERKKQKEKERKERLKKEGKLLTKSQREARARAEATLKL
LQAQGVEVPSKDSLPKKRPIYEDKKRKKIPQQLESKEVSESMELCAAVEV
MEQGVPEKEETPPPVEPEEEEDTEDAGLDDWEAMASDEETEKVEGNKVHI
EVKENPEEEEEEEEEEEEDEESEEEEEEEGESEGSEGDEEDEKVSDEKDS
GKTLDKKPSKEMSSDSEYDSDDDRTKEERAYDKAKRRIEKRRLEHSKNVN
TEKLRAPIICVLGHVGTGKTKILDKLRHTHVQDGEAGGITQQIGATNVPL
EAINEQTKMIKNFDRENVRIPGMLIIDTPGHESFSNLRNRGSSLCDIAIL
VVDIMHGLEPQTIESINLLKSKKCPFIVALNKTDRLYDWKKSPDSDVAAT
LKKQKKNTKDEFEERAKAIIVEFAQQGLNAALFYENKDPRTFVSLVPTSA
HTGDGMGSLIYLLVELTQTMLSKRLAHCEELRAQVMEVKALPGMGTTIDV
ILINGRLKEGDTIIVPGVEGPIVTQIRGLLLPPPMKELRVKNQYEKHKEV
EAAQGVKILGKDLEKTLAGLPLLVAYKEDEIPVLKDELIHELKQTLNAIK
LEEKGVYVQASTLGSLEALLEFLKTSEVPYAGINIGPVHKKDVMKASVML
EHDPQYAVILAFDVRIERDAQEMADSLGVRIFSAEIIYHLFDAFTKYRQD
Y
a.a.
length
InterPro Name
length(228), motif(293:520) 228 IPR027417 P-loop containing nucleoside triphosphate hydrolase [Domain]
length(299), motif(297:595) 299 IPR027417 P-loop containing nucleoside triphosphate hydrolase [Domain]
length(211), motif(307:517) 211 IPR000795 Elongation factor, GTP-binding domain [Domain]
length(14), motif(308:321) 14 IPR000795 Elongation factor, GTP-binding domain [Domain]
length(146), motif(309:454) 146 IPR005225 Small GTP-binding protein domain [Domain]
length(11), motif(374:384) 11 IPR000795 Elongation factor, GTP-binding domain [Domain]
length(12), motif(390:401) 12 IPR000795 Elongation factor, GTP-binding domain [Domain]
length(10), motif(426:435) 10 IPR000795 Elongation factor, GTP-binding domain [Domain]
length(75), motif(545:619) 75 IPR004161 Translation elongation factor EFTu/EF1A, domain 2 [Domain]
length(112), motif(639:750) 112 IPR023115 Translation initiation factor IF- 2, domain 3 [Domain]
length(106), motif(640:745) 106 IPR023115 Translation initiation factor IF- 2, domain 3 [Domain]
length(78), motif(655:732) 78 IPR023115 Translation initiation factor IF- 2, domain 3 [Domain]